KEGG   Macaca mulatta (rhesus monkey): 696595
Entry
696595            CDS       T01028                                 

Gene name
KCNF1
Definition
(RefSeq) potassium voltage-gated channel subfamily F member 1
  KO
K04899  potassium voltage-gated channel subfamily F member 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mcc04040]
    696595 (KCNF1)
Ion channels [BR:mcc04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   696595 (KCNF1)
SSDB
Motif
Pfam: Ion_trans BTB_2 Ion_trans_2 PKD_channel
Other DBs
NCBI-GeneID: 696595
NCBI-ProteinID: NP_001244508
UniProt: G7NBA5 H9FU59
Position
13
AA seq 494 aa
MDGSGERSLPEPGSQSSAASDDIEIVVNVGGVRQVLYGDLLSQYPETRLAELINCLAGGY
DTIFSLCDDYDPGKREFYFDRDPDAFKCVIEVYYFGEVHMKKGICPICFKNEMDFWKVDL
KFLDDCCKSHLSEKREELEEIARRVQLILDDLGVDAAEGRWRRCQKCVWKFLEKPESSCP
ARVVAVLSFLLILVSSVVMCMGTIPELQVLDAEGNRVEHPTLENVETACIGWFTLEYLLR
LFSSPNKLHFALSFMNIVDVLAILPFYVSLTLTHLGARMMELTNVQQAVQALRIMRIARI
FKLARHSSGLQTLTYALKRSFKELGLLLMYLAVGIFVFSALGYTMEQSHPETLFKSIPQS
FWWAIITMTTVGYGDIYPKTTLGKLNAAISFLCGVIAIALPIHPIINNFVRYYNKQRVLE
TAAKHELELMELNSSSGGEGKTGGSRSDLDNLPPEPAGKEAPSCSSRLKLSHSDTFIPLL
TEEKHHRTRLQSCK
NT seq 1485 nt   +upstreamnt  +downstreamnt
atggacgggtccggggagcgcagcctcccggagcccggcagccagagctccgcggccagc
gacgacatcgagatagtcgtcaacgtggggggcgtgcggcaggtactgtacggggacctc
ctcagccagtacccggagaccaggctggcggagctcatcaactgcttggcggggggctac
gacaccatcttctctctgtgcgacgactacgaccccggcaagcgcgagttctactttgac
agggacccggacgccttcaagtgtgtcatcgaggtgtactatttcggggaggtccacatg
aagaagggcatctgccccatctgcttcaagaacgagatggacttctggaaggtggatctc
aagttcctggacgactgttgcaagagccacctgagcgagaagcgcgaggaactggaggag
atcgcgcgccgcgtgcagctcatcttggacgacctgggcgtggacgcggccgagggccgc
tggcgccgctgccagaagtgcgtctggaagttcctggagaagcctgagtcgtcgtgcccg
gcgagagtggtggccgtgctctccttcctgctcatcctcgtctcgtctgtggtcatgtgt
atgggcaccatccccgagctgcaggtgctggacgccgagggcaaccgcgtggagcaccca
acgctggagaacgtggagacggcatgcatcggctggttcaccctggagtacctgctgcgc
ctcttctcgtcgcccaataagctgcacttcgcgctgtccttcatgaatatcgtggacgtg
ctggccatcctccccttctatgtgagcctcacgctcacgcacctgggtgcccgcatgatg
gaactgaccaacgtgcagcaggccgtgcaggcgctgcggatcatgcgcatcgcgcgcatc
ttcaagctggcccgccactcctcgggcctgcagaccctcacctatgccctcaagcgcagc
ttcaaggaactggggctgctgctcatgtacctggcagtgggcatcttcgtcttctctgcc
ctgggctacaccatggagcagagccacccagagaccctgtttaagagcatcccccagtcc
ttctggtgggccatcatcaccatgaccaccgtcggctacggcgacatctaccccaagacc
acgctgggcaagctcaacgcagccatcagcttcttgtgcggcgtcatcgccatcgccctg
cccatccaccccatcatcaacaacttcgtgaggtactacaacaagcagcgcgtcctggag
acggcggccaagcacgagctggagctgatggaactcaactccagcagcgggggcgagggc
aagaccgggggctcccgcagtgacctggacaacctccctccggagcctgcagggaaggag
gcgccgagctgcagcagccggctgaagctctcccacagcgacaccttcatccccctcctg
accgaggagaagcaccacaggacccggctccagagttgcaagtga

DBGET integrated database retrieval system