KEGG   Macaca mulatta (rhesus monkey): 696709Help
Entry
696709            CDS       T01028                                 

Gene name
RAC2
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
  KO
K07860  Ras-related C3 botulinum toxin substrate 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04310  Wnt signaling pathway
mcc04360  Axon guidance
mcc04370  VEGF signaling pathway
mcc04510  Focal adhesion
mcc04520  Adherens junction
mcc04650  Natural killer cell mediated cytotoxicity
mcc04662  B cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04670  Leukocyte transendothelial migration
mcc04810  Regulation of actin cytoskeleton
mcc05163  Human cytomegalovirus infection
mcc05200  Pathways in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
mcc05231  Choline metabolism in cancer
mcc05416  Viral myocarditis
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    696709 (RAC2)
   04015 Rap1 signaling pathway
    696709 (RAC2)
   04010 MAPK signaling pathway
    696709 (RAC2)
   04310 Wnt signaling pathway
    696709 (RAC2)
   04370 VEGF signaling pathway
    696709 (RAC2)
   04071 Sphingolipid signaling pathway
    696709 (RAC2)
   04024 cAMP signaling pathway
    696709 (RAC2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    696709 (RAC2)
   04520 Adherens junction
    696709 (RAC2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    696709 (RAC2)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    696709 (RAC2)
   04662 B cell receptor signaling pathway
    696709 (RAC2)
   04664 Fc epsilon RI signaling pathway
    696709 (RAC2)
   04666 Fc gamma R-mediated phagocytosis
    696709 (RAC2)
   04670 Leukocyte transendothelial migration
    696709 (RAC2)
   04062 Chemokine signaling pathway
    696709 (RAC2)
  Development
   04360 Axon guidance
    696709 (RAC2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    696709 (RAC2)
   05231 Choline metabolism in cancer
    696709 (RAC2)
   05210 Colorectal cancer
    696709 (RAC2)
   05212 Pancreatic cancer
    696709 (RAC2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    696709 (RAC2)
   05416 Viral myocarditis
    696709 (RAC2)
  Infectious diseases
   05163 Human cytomegalovirus infection
    696709 (RAC2)
GTP-binding proteins [BR:mcc04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    696709 (RAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf
Motif
Other DBs
NCBI-GeneID: 696709
NCBI-ProteinID: NP_001248306
Ensembl: ENSMMUG00000048761
UniProt: H9ZBW4
Position
10
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR
DDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRQQKRACSLL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagatggggccgtgggcaagacctgccttctc
atcagctacaccaccaacgccttccccggagagtacatccccaccgtgtttgacaactat
tcagccaatgtgatggtggacagcaagccggtgaacctggggctgtgggacactgctggg
caggaggactacgaccgtctccggccactctcctacccacagacggacgtcttcctcatc
tgcttctccctcgtcagcccagcctcctatgagaacgtccgtgccaagtggttcccggaa
gtgcggcaccactgccccagcacacccatcatcctggtgggcaccaagctggacctgcgg
gacgacaaggacaccatcgagaaactgaaggagaagaagctggctcccatcacctaccct
cagggcctggcactggccaaggagattgactcggtgaaatatctggagtgctcagccctc
acccagagaggcctgaaaaccgtgttcgacgaagccatccgggccgtgctgtgccctcag
cccacgcggcagcagaagcgcgcctgcagcctcctctag

DBGET integrated database retrieval system