KEGG   Macaca mulatta (rhesus monkey): 696749
Entry
696749            CDS       T01028                                 

Gene name
RUNX1
Definition
(RefSeq) runt-related transcription factor 1
  KO
K08367  runt-related transcription factor 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04530  Tight junction
mcc04659  Th17 cell differentiation
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05220  Chronic myeloid leukemia
mcc05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    696749 (RUNX1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    696749 (RUNX1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    696749 (RUNX1)
   05202 Transcriptional misregulation in cancer
    696749 (RUNX1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    696749 (RUNX1)
   05220 Chronic myeloid leukemia
    696749 (RUNX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    696749 (RUNX1)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Runt
    696749 (RUNX1)
SSDB
Motif
Pfam: Runt RunxI DUF3037
Other DBs
NCBI-GeneID: 696749
NCBI-ProteinID: NP_001252891
Ensembl: ENSMMUG00000001649
UniProt: H9YWG8
Position
3
AA seq 480 aa
MASDSIFESFPSYPQCFMRECILGMNPPRDVHDASTSRRFTPPSTALSPGKMSEALPLGA
PDAGAALAGKLRSGDRSMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVA
LGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVF
TNPPQVATYHRAIKITVDGPREPRRHRQKLDDQTKPGSLSFSERLSELEQLRRTAMRVSP
HHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPAT
PISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFPALPSISDPRMHYPGAFTYSPTPV
TSGIGIGMSAMGSATRYHTYLPPPYPGSSQAQGGPFQASSPSYHLYYGASAGSYQFSMVG
GERSPPRILPPCTNASTGSALLNPSLPNQSDVVEAEGSHSNSPTNMAPAARLEEAVWRPY
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggcttcagacagcatatttgagtcatttccttcatacccacagtgcttcatgagagaa
tgcatacttggaatgaatcctcctagagacgtccacgatgccagcacgagccgccgcttc
acgccgccttccaccgcgctgagcccaggcaagatgagcgaggcgttgccgctgggcgcc
ccggacgccggcgctgcgctggccggcaagctgaggagcggcgaccgcagcatggtggag
gtgctggccgaccacccgggcgagctggtgcgcaccgacagccccaacttcctctgctcc
gtgctgcctacgcactggcgctgcaacaagaccctgcccatcgctttcaaggtggtggcc
ctaggggatgttccagatggcactctggtcactgtgatggccggcaatgatgaaaactac
tcggctgagcttagaaatgctaccgcagccatgaagaaccaagttgcaagatttaatgac
ctcaggtttgtcggtcgaagtggaagagggaaaagcttcactctgaccatcactgtcttc
acaaacccaccgcaagtcgccacctaccacagagccatcaaaatcacagtggatgggccc
cgagaacctcgaagacatcggcagaaactagatgatcagaccaagcccgggagcttgtcc
ttttccgagcggctcagtgaactggagcagctgcggcgcacagccatgagggtcagccca
caccacccagcccccacgcccaaccctcgtgcctccctgaaccactccactgcctttaac
cctcagcctcagagtcagatgcaggatacaaggcagatccagccatccccaccgtggtcc
tatgatcagtcctaccaatacctgggatccattgcctctccttctgtgcacccagcaacg
cccatttcacctggacgtgccagcggcatgacaaccctctctgcagaactttccagtcga
ctctcaacggcacccgacctgacggccttcagcgacccgcgccagttccccgcgctgccc
tccatctctgacccccgcatgcactacccaggcgccttcacctactccccgacgccagtc
acctcgggcatcggcatcggcatgtcggccatgggctcggccacgcgctaccacacctac
ctgccgccgccctaccccggctcgtcgcaagcgcagggcggcccattccaagccagttcg
ccctcctaccacctgtactacggcgcctcggccggctcctaccagttctccatggtgggc
ggcgagcgctcgccgccgcgcatcctgccgccctgcaccaacgcctccaccggctccgcg
ctgctcaaccccagcctcccgaaccagagcgacgtggtggaggccgagggcagccacagc
aactcccccaccaacatggcgcccgccgcgcgcctggaggaggccgtgtggaggccctac
tga

DBGET integrated database retrieval system