KEGG   Macaca mulatta (rhesus monkey): 696893Help
Entry
696893            CDS       T01028                                 

Gene name
IMPAD1
Definition
(RefSeq) inositol monophosphatase domain containing 1
  KO
K15759  inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00562  Inositol phosphate metabolism
mcc00920  Sulfur metabolism
mcc01100  Metabolic pathways
mcc04070  Phosphatidylinositol signaling system
Module
mcc_M00131  Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    696893 (IMPAD1)
  Energy metabolism
   00920 Sulfur metabolism
    696893 (IMPAD1)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    696893 (IMPAD1)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     696893 (IMPAD1)
    3.1.3.25  inositol-phosphate phosphatase
     696893 (IMPAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-GeneID: 696893
NCBI-ProteinID: NP_001244879
Ensembl: ENSMMUG00000014650
UniProt: F7FZ79
Position
8
AA seq 359 aa AA seqDB search
MAPMGIRLSPLGVAVFCLLGLGVLYHLYSGFLAGRFSLFGLSSEPGGGAAGPAAAADGGT
VDLREMLAVSVLAAVRGGDEVRRVRESNVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYL
LKTAFPSVQINTEEHVDAADQEVILWDHKIPEDILKEVTTPKEVPAESVTVWIDPLDATQ
EYTEDLRKYVTTMVCVAVNGKPVLGVIHKPFSEYTAWAMVDGGSNVKARSSYNEKTPRIV
VSRSHSGMVRQVALQTFGNQTTIIPAGGAGYKVLALLDVPDKSQEKADLYIHVTYIKKWD
ICAGNAILKALGGHMTTLSGEEISYTGSDGIEGGLLASIRMNHQALVRKLPDLEKTGHK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcacccatgggcatccgcctttccccactgggggtggccgtgttttgcctgctgggg
ctcggcgtgctctaccacctctactcgggcttcctggctggccgcttcagcctcttcggc
ctgagcagcgagcctggcggcggcgcggcgggacccgcggccgcggccgacgggggcacc
gtggacttgcgcgagatgctggctgtgtcagtgctggccgcagtccgcggcggcgacgag
gtgaggcgagtccgcgagagcaatgtcctccacgagaagtccaaggggaagacgcgcgag
ggagccgaggacaagatgaccagcggcgacgtgctgtccaaccgcaagatgttctacctg
ctcaagaccgccttccccagcgtccagataaatactgaggaacacgtggatgcagctgat
caggaggttatcttgtgggatcataagattcctgaggatatcctaaaggaagtaactact
cctaaagaggtgccagcagaaagtgttactgtctggattgacccacttgatgctacacag
gaatatacagaggatcttcgaaagtacgtcactactatggtgtgtgtagctgtaaatggt
aaacctgtgttaggagttatacataagccattttccgaatatacagcttgggcaatggta
gatggtggttcaaatgtgaaagcccgctcttcctacaatgagaagaccccaaggatcgtt
gtgtctcgttcccattcagggatggtcagacaggtcgctcttcagacttttggaaaccag
actacaattatcccagctggtggtgctggttataaagttttagcacttttggatgtgcct
gataagagtcaagaaaaagctgatttatatatccatgtgacatacatcaaaaagtgggat
atatgtgctggtaatgccatcttaaaagcccttggggggcatatgactaccctgagtggt
gaagaaatcagttacactggttcagacggcattgaagggggactccttgctagcatcaga
atgaaccaccaggccctggtcagaaaactcccagatctagaaaagacaggacataaataa

DBGET integrated database retrieval system