KEGG   Macaca mulatta (rhesus monkey): 698140
Entry
698140            CDS       T01028                                 
Symbol
RENBP
Name
(RefSeq) N-acylglucosamine 2-epimerase isoform X1
  KO
K01787  N-acylglucosamine 2-epimerase [EC:5.1.3.8]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00520  Amino sugar and nucleotide sugar metabolism
mcc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    698140 (RENBP)
Enzymes [BR:mcc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.8  N-acylglucosamine 2-epimerase
     698140 (RENBP)
SSDB
Motif
Pfam: GlcNAc_2-epim
Other DBs
NCBI-GeneID: 698140
NCBI-ProteinID: XP_014984022
Ensembl: ENSMMUG00000000320
UniProt: F6YUM9
Position
X:complement(149923387..149933020)
AA seq 431 aa
MSKGLRARQTSGGDMEKERETLQAWKERVAQELDRVVAFWMEHSHDQEHGGFFTCLGREG
RVYDDLKYVWLQGRQVWMYCRLYRTFQRFHHSQLLNAAKAGGEFLLRYARLAPPGKKCAF
VLTRDGRPVKVQRTIFSECFYTMAMNELWRATGEVQYQTEAVEMMDQIVHWVREDASGLG
RPQLQGAPTAEPMAVPMMLLNLVEQLGEADEELAGKYTELGDWCAQRILQHVQRDGQAVL
ENVSEDGKELSGCLGRQQNPGHALEAGWFLLRHCIRKGDPELRAHVVDKFLLLPFRSGWD
PDHGGLFYFQDADDFCPTQLEWAMKLWWPHSEAMIAFLMGYSESGDPVLLRLFYQVAEYT
FRQFRDPEYGEWFGYLSREGKVALSIKGGPFKGCFHVPRCLAMCEEMLGALLSRPAPTPT
PVPTPARRGAE
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgagcaagggtctccgagcgcggcagaccagtggtggggacatggagaaagagcgagag
actctgcaggcctggaaggagcgcgtggcgcaggagctggaccgtgtagtggcgttctgg
atggagcactcccacgaccaggagcacgggggcttcttcacgtgccttggccgcgaggga
cgggtgtatgatgacctcaagtacgtgtggctgcaggggaggcaggtgtggatgtattgt
cgcctgtaccgcactttccagcgcttccaccactctcagcttctgaatgcagcaaaagca
ggtggtgagttcttgctgcgttatgcccggctggcacctcctggcaagaagtgtgccttt
gtgctgactcgggacggccgtccggtcaaggtgcagcggaccatcttcagcgagtgtttc
tacaccatggccatgaacgagctgtggagggccacaggggaagtacagtaccagacggaa
gccgtggagatgatggatcagattgtccactgggtgcgggaggacgcgtcgggactgggc
cggccccagctccagggggccccgactgcggagcccatggcggtgcccatgatgctgctg
aacctggtagagcagcttggggaggcagatgaggagctggcaggcaaatacacagagctg
ggggactggtgcgcccagaggattctgcagcacgtgcagagggatggacaagctgtgctg
gagaatgtgtcagaggatggcaaggaactttctggctgcctggggagacagcagaaccca
ggccacgcactggaggccggctggtttctgctccgtcattgcattcggaaaggcgaccct
gaacttcgagcccacgtggttgacaagttcctgttgttgcccttccgctccggatgggac
cctgaccatggaggcctcttttacttccaggatgctgatgacttctgccccacccagctg
gagtgggccatgaagctctggtggccacacagcgaagccatgattgccttcctcatgggt
tacagtgagagtggggaccctgtgctgctgcgcctcttctaccaagtggctgagtacacc
ttccgccagtttcgcgatcccgagtacggggaatggtttggctacctgagccgagagggc
aaggtggccctctccatcaagggaggtcctttcaaaggctgcttccacgtgccgcggtgc
ctagccatgtgcgaggagatgctgggcgccctgctgagccgccccgcccccacgccgacg
cccgtccccacccccgcccgtcgaggcgcggaataa

DBGET integrated database retrieval system