KEGG   Macaca mulatta (rhesus monkey): 698349
Entry
698349            CDS       T01028                                 

Gene name
SEM1
Definition
(RefSeq) 26S proteasome complex subunit SEM1
  KO
K10881  26 proteasome complex subunit DSS1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc03050  Proteasome
mcc03440  Homologous recombination
mcc05010  Alzheimer disease
mcc05012  Parkinson disease
mcc05014  Amyotrophic lateral sclerosis
mcc05016  Huntington disease
mcc05017  Spinocerebellar ataxia
mcc05020  Prion disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    698349 (SEM1)
  09124 Replication and repair
   03440 Homologous recombination
    698349 (SEM1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    698349 (SEM1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    698349 (SEM1)
   05012 Parkinson disease
    698349 (SEM1)
   05014 Amyotrophic lateral sclerosis
    698349 (SEM1)
   05016 Huntington disease
    698349 (SEM1)
   05017 Spinocerebellar ataxia
    698349 (SEM1)
   05020 Prion disease
    698349 (SEM1)
   05022 Pathways of neurodegeneration - multiple diseases
    698349 (SEM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mcc03019]
    698349 (SEM1)
   04131 Membrane trafficking [BR:mcc04131]
    698349 (SEM1)
   03051 Proteasome [BR:mcc03051]
    698349 (SEM1)
   03400 DNA repair and recombination proteins [BR:mcc03400]
    698349 (SEM1)
Messenger RNA biogenesis [BR:mcc03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    TREX-2 complex
     698349 (SEM1)
Membrane trafficking [BR:mcc04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    698349 (SEM1)
Proteasome [BR:mcc03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     698349 (SEM1)
DNA repair and recombination proteins [BR:mcc03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     698349 (SEM1)
SSDB
Motif
Pfam: DSS1_SEM1
Other DBs
NCBI-GeneID: 698349
NCBI-ProteinID: NP_001253734
UniProt: I0FV70 G7MLU2
Position
3
AA seq 70 aa
MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAEL
EKHGYKMETS
NT seq 213 nt   +upstreamnt  +downstreamnt
atgtcagagaaaaagcaacccgtagacttaggtctcttagaggaagacgacgagtttgaa
gagttcccggccgaagactgggctggcttagatgaagatgaagatgcacatgtctgggag
gataattgggatgatgacaatgtagaggatgacttttctaatcagttacgagctgaacta
gagaaacatggttataagatggagacttcatag

DBGET integrated database retrieval system