KEGG   Macaca mulatta (rhesus monkey): 698636Help
Entry
698636            CDS       T01028                                 

Gene name
CREM
Definition
(RefSeq) cAMP-responsive element modulator isoform X11
  KO
K09052  cAMP response element modulator
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    698636 (CREM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    698636 (CREM)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    698636 (CREM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 pKID bZIP_2 bZIP_Maf
Motif
Other DBs
NCBI-GeneID: 698636
NCBI-ProteinID: XP_001090477
Ensembl: ENSMMUG00000022508
Position
9
AA seq 269 aa AA seqDB search
MWWHQHNLCFRRPIEEDYSSRDVEEKVATIAETDESAESEGVIDSHKRREILSRRPSYRK
ILNELSSDVPGVPKIEEEKSEEEGTPPNIATMAVPTSIYQTSTGQYIAIAQGGTIQISNP
GSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVPGSQVVVQAATGDMPTYQI
RAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLE
SRVAVLEVQNKKLIEELETLKDICSPKTD
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtggtggcatcagcataatctatgtttcaggcgtcctatagaggaggattattcttca
agggatgtggaagaaaaggtagcaacaattgcagagacagatgaatctgcagaatcagaa
ggtgtaattgattctcataaacgtagagaaatcctttcacgaagaccctcttataggaaa
atactgaatgaactgtcctctgatgtgcctggtgttcccaagattgaagaagaaaaatca
gaggaagaaggaacaccgcctaacattgctaccatggcagtaccaactagcatatatcag
actagcacggggcaatacattgctatagcccaaggtggaacaatccagatttctaaccca
ggatctgatggtgttcagggactgcaggcattaacaatgacaaattcaggagctcctcca
ccaggtgctacaattgtacagtatgcagcacaatcagctgatggcacacagcagttcttt
gtcccaggcagccaggttgttgttcaagctgccactggtgacatgccaacttaccagatc
cgagctcctactgctgctttgccacagggagtggtgatggctgcatcacccggaagtttg
cacagtccccagcagctggcagaagaagcaacacgcaaacgagagctgaggctaatgaaa
aacagggaagctgccaaagaatgtcgacgtcgaaagaaagaatatgtaaaatgtctggag
agccgagttgcagtgctggaagtccagaacaagaagcttatagaggaacttgaaaccttg
aaagacatttgttctcccaaaacagattag

DBGET integrated database retrieval system