KEGG   Macaca mulatta (rhesus monkey): 699203Help
Entry
699203            CDS       T01028                                 

Gene name
THNSL2
Definition
(RefSeq) threonine synthase-like 2 isoform X1
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    699203 (THNSL2)
Enzymes [BR:mcc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     699203 (THNSL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP AMP_N
Motif
Other DBs
NCBI-GeneID: 699203
NCBI-ProteinID: XP_014968303
Ensembl: ENSMMUG00000008056
Position
13
AA seq 485 aa AA seqDB search
MWYVSTRGIAPRVNFEGALFSGYAPDGGLFMPEELPQLDRETLCQWSTLSYPGLVKELCA
LFIGSELIPKDDLNDLIDRAFSRFRHREVVHLSRLRNGLNVLELWHGVTYAFKDLSLSCT
AQFLQYFLEKREKHVTVVVGTSGDTGSAAIESVQGAKNVDIIVLLPKGHCTKIQELQMTT
VLKENVHVFGVEGNSDELDEPIKTVFADVAFVKKHNLMSLNSINWSRVLVQMAHHFFAYF
QCTPSLDTHPLPLVEVVVPTGAAGNLAAGYIAQKIGLPIRLVVVVNRNDIIHRTVQQGDF
SLSEAVKSTLASAMDIQVPYNMERVFWLLSGCDSQVTRALMEQFERTQSVNLPKELHSKL
SEVVTSESVSDEAITQTMGRCWDENQYLLCPHSAVAVNYHYQQMDRQEPSSTPRCCLAPA
SAAKFPEAVLAAGLTPETPAEIVALEHKETRCTPMRRGDNWTLMLQDTIEDLSRRWRGHA
LNASQ
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtggtacgtcagcaccaggggcatagccccacgggtcaactttgagggggccctcttc
tctggctatgcacccgatggaggcctctttatgccggaagagctcccacagttggacaga
gagaccctgtgccagtggagcacactctcctatcctggcctggtgaaggagctgtgtgcc
ctcttcatcggctctgagctcattccaaaagatgacttaaatgatctgatcgaccgagcc
ttcagcagattccgtcacagagaggtggtccatctgtccaggttgaggaacgggctgaac
gtgttggagctgtggcatggtgtcacatatgcatttaaggacctgtccctgtcctgcaca
gcacagttcctgcagtacttcctggagaagagggagaagcacgtcactgtggttgtagga
acgtctggggacacaggaagtgctgccattgagagtgttcaaggggcaaagaacgtggac
attatcgttctactgcccaaaggtcactgcacaaagattcaggagctccagatgacaacg
gtgctgaaggagaacgtacatgtgtttggagtggagggaaacagcgatgagctcgatgag
ccgatcaagactgtgtttgccgacgtggcttttgtcaagaagcacaatctgatgagcctg
aattcgatcaactggtcccgggtcctggtgcagatggcccaccacttctttgcttacttc
cagtgtacgccatccttggacacgcatcccctacccctggtggaggtggttgtgccaaca
ggggctgccggtaaccttgcagctgggtacattgctcagaagataggcctgcccatccgt
ctggtcgtggtagtgaaccgcaatgacatcatccacaggactgtccagcagggagacttc
tctctgtctgaggctgttaaatcaaccttggcatcagctatggacattcaggtgccctac
aacatggagagggtattctggctactctctggctgtgacagccaggtgacaagagccctc
atggagcagtttgaaaggacccaaagtgtgaatctgcccaaggaactgcacagcaagctt
tcagaggtggtgacatccgagtcagtgtctgatgaagccatcacccagaccatgggccgc
tgctgggatgagaaccagtatttgctgtgcccccactcggcggtggccgtgaactaccat
taccagcagatggacaggcaggagcccagcagcactccccggtgctgccttgcccctgcc
tctgcagccaagttcccggaagctgtcctggctgctggcctgacccctgagactcctgca
gagatcgtagccctggagcacaaggagacacgctgcaccccgatgcggagaggtgacaac
tggaccctgatgcttcaggacaccattgaggaccttagccgacggtggaggggtcatgcc
ctcaacgcctcccagtag

DBGET integrated database retrieval system