KEGG   Macaca mulatta (rhesus monkey): 699438Help
Entry
699438            CDS       T01028                                 

Gene name
CXCR3
Definition
(RefSeq) C-X-C motif chemokine receptor 3
  KO
K04188  C-X-C chemokine receptor type 3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    699438 (CXCR3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    699438 (CXCR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mcc04030]
    699438 (CXCR3)
   04050 Cytokine receptors [BR:mcc04050]
    699438 (CXCR3)
   04090 CD molecules [BR:mcc04090]
    699438 (CXCR3)
G protein-coupled receptors [BR:mcc04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    699438 (CXCR3)
Cytokine receptors [BR:mcc04050]
 Chemokine receptors
  CXC Chemokine
   699438 (CXCR3)
CD molecules [BR:mcc04090]
 Proteins
  699438 (CXCR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 Ctr 7TM_GPCR_Srsx CBP_BcsG
Motif
Other DBs
NCBI-GeneID: 699438
NCBI-ProteinID: NP_001138512
UniProt: B8PY99
Position
X
AA seq 368 aa AA seqDB search
MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDRAFLPALY
SLLFLLGLLGNGAVAAVLLSRRAALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFG
SGLCKVAGALFNINFYAGALLLACISFDRYLNIVHATQLYRRGPPARVTLTCLAVWGLCL
LFALPDFIFLSAHHDERLNATHCQYNFPQVGRTALRVLQLVAGFLLPLLVMAYCYAHILA
VLLVSRGQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAK
SVTSGLGYMHCCLNPLLYAFVGVKFRERMWMLLLRLGCPNQRGLQRQPSSSRRDSSWSET
SEASYSGL
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggtccttgaggtgagtgaccaccaagtgctaaatgacgccgaggttgccgccctcctg
gagaacttcagctcttcctatgactatggagaaaacgagagtgactcgtgctgtacctcc
ccgccctgcccacaggacttcagcctgaacttcgaccgggccttcctgccagccctctac
agcctcctctttctgctggggctgctgggcaacggcgcggtggcagcggtgctgctgagc
cggcgggcagccctgagcagcaccgacaccttcctgctccacctggctgtggcagacacg
ctgctggtgctgacgctcccactctgggcagtggacgctgccgtccagtgggtctttggc
tctggcctctgcaaagtggcaggtgccctcttcaacatcaacttctacgcaggggccctc
ctgctggcctgcatcagctttgaccgctacctgaacatagtgcacgccacccagctctac
cgcagggggcccccggcccgcgtgaccctcacctgcctggctgtctgggggctctgcctg
ctcttcgccctcccagacttcatcttcctgtcggcccaccatgacgagcgcctcaacgcc
acccactgccagtacaacttcccacaggtgggccgcacggctctgcgggtgctgcagctg
gtggctggctttctgctgcccctgctggtcatggcctactgctatgcccacatcctggcc
gtgctgctggtctccaggggccagcggcgcctgcgggccatgcggctggtggtggcggtc
gtggtggcctttgccctctgctggaccccctatcacctggtggtgctggtggacatcctc
atggacctgggcgctttagcccggaactgtggccgagaaagcagggtagacgtggccaag
tcggtcacctcaggcctgggctacatgcactgctgcctcaacccgctgctctatgccttt
gtaggggtcaagttccgggagcggatgtggatgctgctcttgcgcctgggctgccccaac
cagagagggctccagaggcagccatcgtcttcccgccgggattcatcctggtctgagacc
tcagaggcctcctactcgggcttgtga

DBGET integrated database retrieval system