KEGG   Macaca mulatta (rhesus monkey): 699941
Entry
699941            CDS       T01028                                 
Symbol
AGXT
Name
(RefSeq) serine--pyruvate aminotransferase isoform X1
  KO
K00830  alanine-glyoxylate transaminase / serine-glyoxylate transaminase / serine-pyruvate transaminase [EC:2.6.1.44 2.6.1.45 2.6.1.51]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00250  Alanine, aspartate and glutamate metabolism
mcc00260  Glycine, serine and threonine metabolism
mcc00630  Glyoxylate and dicarboxylate metabolism
mcc01100  Metabolic pathways
mcc01200  Carbon metabolism
mcc04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    699941 (AGXT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    699941 (AGXT)
   00260 Glycine, serine and threonine metabolism
    699941 (AGXT)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    699941 (AGXT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mcc01007]
    699941 (AGXT)
Enzymes [BR:mcc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.44  alanine---glyoxylate transaminase
     699941 (AGXT)
    2.6.1.45  serine---glyoxylate transaminase
     699941 (AGXT)
    2.6.1.51  serine---pyruvate transaminase
     699941 (AGXT)
Amino acid related enzymes [BR:mcc01007]
 Aminotransferase (transaminase)
  Class V
   699941 (AGXT)
SSDB
Motif
Pfam: Aminotran_5 Aminotran_1_2
Other DBs
NCBI-GeneID: 699941
NCBI-ProteinID: XP_001090301
Ensembl: ENSMMUG00000023435
UniProt: A0A8J8YBD3 F7F4Q3
Position
12:128289893..128300065
AA seq 414 aa
MFQALAKSSAAPGPQAAGWVQTMASHKLLVPPPKALLKPLSIPKRLLLGPGPSNLPPRIM
SAGGMQIIGPMDKEMYQIMDEIKEGIQYVFQTRNPLTLVITGSGHCALEAALVNVLEPGD
SFLVGVNGIWGQRAMDIGERMGARVHPMTKDPGGHYTLQEVEEGLAQHKPVLLFLTHGES
STGVLQPLDGFGELCHRYKCLLLVDSVVSLGGTPLYMDQQGIDILYSGSQKVLNAPPGTS
FISFSDKAKKKMYSRKTKPFSFYLDIKWLANFWGCDGQPRMYHHTIPVISLYSLRESLAL
IAEQGLENSWRQHRETTAYLHGRLQALGLQLFVKDPALRLPMVTTVVVPAGYDWRDIVSY
VLDHFDIEIMGGLGPSAGKVLRIGLLGCNATRENVDRVTEALGAALQHCPKNKL
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgttccaggctctggccaagtccagtgcagccccaggtccccaagcggcaggttgggtg
cagaccatggcctctcacaagctgctggtgcccccgcccaaggccctgctcaagcccctc
tccatccccaagcggctcctgctggggcccggtccctccaacctgcctcctcgcatcatg
tcggccggaggaatgcagatcatcgggccaatggacaaggagatgtaccagatcatggac
gagatcaaggaaggcatccagtacgtgttccagaccaggaacccgctcacactggtcatc
actggctccggacactgtgccctggaggccgccctggtcaatgtgctggagcctggggac
tccttcctggtcggggtcaatggcatttgggggcagcgagccatggacatcggggagcgc
atgggagcccgagtgcacccaatgaccaaggaccctggaggccactacacactgcaggag
gtggaggagggcctggcccagcacaagccggtgctgctgttcttgacccacggggagtcg
tccaccggcgtgctgcagccccttgacggttttggggaactctgccacaggtacaagtgc
ctgctcctggtggattcggtggtatccctgggtgggacccctctctacatggaccagcaa
ggcatcgacatcctgtactcgggctcccagaaggtcctgaacgcccccccagggacctcg
ttcatctccttcagtgacaaggccaaaaagaagatgtactcccgcaagacgaagcccttc
tccttctacctggacatcaagtggctggccaacttctggggttgtgacggccagcccagg
atgtaccatcacacgatccccgtcatcagcctgtacagcctgagagagagcctggccctc
attgcggaacagggcctggagaacagctggcgccagcaccgcgagaccacagcgtatctg
catgggcgcctgcaggcactggggttgcagctctttgtgaaggacccagcgctccggctg
cccatggtcactaccgtagttgtgcccgctggctatgactggcgagacatcgtcagctac
gtcttggaccatttcgacattgagatcatgggcggcctcgggccctccgcagggaaggtg
ctgcggatcggcctgctgggctgcaatgccacccgcgagaatgtggaccgcgtgacggag
gccctgggggcggccttgcagcactgccccaagaacaagctgtga

DBGET integrated database retrieval system