KEGG   Macaca mulatta (rhesus monkey): 699996
Entry
699996            CDS       T01028                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1 isoform X1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mcc01002]
    699996 (ERAP1)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     699996 (ERAP1)
Peptidases and inhibitors [BR:mcc01002]
 Metallo peptidases
  Family M1
   699996 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 699996
NCBI-ProteinID: XP_001094790
Ensembl: ENSMMUG00000002063
Position
6
AA seq 941 aa
MVFPSLKRSLATMSFLLSSLLALLTVSTPSWCQISEASPKGSNGMPFPWNKIRLPEYVIP
VHYDLLIHANLTTLTFGGTTEVEITASQPTRTIILHSHHLQISRATLRKGAGERLSEEPL
QVLEHPPQEQIALLAPEPLLVGLLYTVVIHYAGNLSETFHGFYKSTYRTKEGELRILAST
QFEPTAARMAFPCFDEPAFKASFSIKIRREPRHLAISNMPLVKSVTVAEGLIEDHFDVTV
KMSTYLVAFIISDFESVSKITKSGVKVSVYAVPDKINQADYALDAAVTLLDFYEDYFNIP
YPLPKQDLAAIPDFQSGAMENWGLTTYRESALLFDAEKSSASSKLGITMIVAHELAHQWF
GNLVTMEWWNDLWLNEGFAKFMEFVSVSVTHPELKVEDYFFGKCFDAMEVDALNSSHPVS
TPVENPAQIREMFDDVSYDKGACILNMLREYLSADAFKSGIVQYLQKHSYKNTKNEDLWD
SMASICPTDGVKGMDGFCSRSQHSSSFSHWHQEGLDVKTMMNTWTLQKGFPLITITVRGR
NVHMKQEHYMKGSEGAPDTGYLWHVPLTFITSKSDMVHRFLLKTKTDVLILPEEVEWIKF
NVGMNGYYIVHYEDDGWDSLTGLLKGTHTAVSSNDRASLINNAFQLVSIGKLSIEKALDL
SLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKAFLIRLLRDLIDKQTWTDEG
SVSERMLRSQLLLLACVRRYQPCVQRAEGYFRKWKESNGNLSLPIDVTLAVFAVGAQSTE
GWDFLYSKYQSSLSSIEKEQIEFALCTTQNKEKLQWLLDESFKGDKIKTQEFPGILVLIG
RNPVGYPLAWKFLRKNWNKLVQKFELGSQSIAHMVMGTTNQFSTRTWLEEVKGFFSSLKE
NGSQLRCVQQTIETIEENIRWMDKNFDKIRVWLQSEKFELL
NT seq 2826 nt   +upstreamnt  +downstreamnt
atggtgtttccgtccctcaaacggtcccttgcaaccatgtcatttctactttcctcactg
ttggctctcttaactgtgtccactccttcatggtgtcagatcagtgaagcatctccaaaa
ggtagtaatgggatgccatttccttggaataaaatacgacttcctgagtatgtcatccca
gttcattatgatctcctgatccatgcaaaccttaccacgctgaccttcgggggaaccacg
gaagtagaaataacagccagtcagcccaccagaaccatcatcctgcatagtcaccacctg
cagatatctagggccaccctcaggaaaggagctggagagaggctatcagaagaaccgctt
caggtcctggaacaccctcctcaggagcaaatcgcgctgctggctcccgagcccctcctt
gtcgggctcctgtacacagttgtcattcactatgctggcaatctttcggagactttccac
ggattttacaaaagcacttacagaaccaaggaaggggaactgaggatacttgcatcaaca
caatttgaacccactgcagctagaatggcctttccctgctttgatgaacctgccttcaaa
gcaagtttctcaatcaaaattagaagagagccaaggcacctagccatctccaatatgcca
ctggtgaaatctgtgactgttgctgaaggactcatagaagaccattttgatgtcactgtg
aagatgagcacctatctggtggccttcattatttcagattttgagtctgtcagcaagata
accaagagtggagtcaaggtttctgtatacgctgtgccagacaagataaatcaagcagat
tatgcactggatgctgcggtgactcttctagatttttatgaggattatttcaacataccg
tatcccctacccaaacaagatcttgctgctattcccgactttcaatctggtgctatggaa
aactggggactaacaacatacagagaatctgctctattgtttgatgcggaaaagtcttct
gcatcaagtaagcttggcatcacaatgattgtggcccatgaactggcccaccagtggttt
gggaacctggtcactatggaatggtggaatgatctttggctaaatgagggatttgccaaa
tttatggagtttgtgtctgtcagtgtgacccatcctgaactgaaagttgaagattatttc
tttggcaaatgttttgatgcaatggaggtagatgctttaaattcctcacaccctgtgtct
acacctgtggagaatcctgctcagatccgggagatgtttgatgatgtttcttatgataag
ggagcttgtattctgaatatgctaagggagtatcttagtgctgatgcatttaaaagtggt
attgtacagtatctccagaagcatagctataaaaatacaaaaaacgaggacctgtgggat
agtatggcaagtatttgccctacagacggtgtaaaagggatggatggcttttgctctaga
agtcaacattcatcttcattctcacattggcatcaggaagggctggatgtgaaaaccatg
atgaacacttggacactgcagaagggttttcccctgataaccatcacagtgaggggaagg
aatgtacacatgaagcaagagcactacatgaagggctctgaaggcgccccggacactggg
tacctgtggcatgttccattgacgttcatcaccagcaaatcagacatggtccatcgattt
ttgctaaaaacaaaaacagatgtgctcatcctcccagaagaggtggaatggatcaaattt
aatgtgggcatgaatggctattacattgtgcattacgaggatgatggatgggactctttg
actggccttttaaaaggaacacacacagcagtcagcagtaacgatcgggcgagtctcatt
aacaatgcatttcagctcgtcagcattgggaagctgtccattgaaaaggccttggattta
tccctgtacttgaaacatgaaactgaaattatgcccgtatttcaaggtttgaatgagctg
attcctatgtataagttaatggagaagagagatatgaatgaagtggaaactcaattcaag
gccttcctcatcaggctgctaagggacctcattgataagcagacgtggacagatgaaggc
tcggtctcagagcgaatgctgcggagtcagctactcctcctcgcctgtgtgcgcaggtat
cagccgtgtgtacagagggcagaaggctatttcaggaagtggaaggaatccaatggaaac
ttgagcctgcctatcgatgtgaccttggcagtgtttgctgtgggcgcccagagcacagaa
ggctgggattttctttatagtaaatatcagtcttctttgtccagtattgagaaagaacaa
attgaatttgccctctgcacaacccaaaataaggaaaagcttcaatggctactagatgaa
agctttaagggagataaaataaaaactcaggagtttccaggaattcttgtactcattggt
aggaacccagtaggatacccactggcctggaaatttctgaggaaaaactggaacaaactt
gtacagaagtttgaacttggctcacaatccatagcccacatggtaatgggtacaacaaat
caattctccacaagaacatggcttgaagaggtaaaaggattcttcagctctttgaaagaa
aatggttctcagctccgttgtgtccaacagacaattgaaaccattgaagaaaacatccgt
tggatggataagaattttgataaaatcagagtgtggctgcaaagtgaaaagtttgaactt
ctgtaa

DBGET integrated database retrieval system