KEGG   Macaca mulatta (rhesus monkey): 700574
Entry
700574            CDS       T01028                                 

Gene name
PPP1R7
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 7 isoform X1
  KO
K17550  protein phosphatase 1 regulatory subunit 7
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    700574 (PPP1R7)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     700574 (PPP1R7)
SSDB
Motif
Pfam: LRR_4 LRR_9 LRR_8
Other DBs
NCBI-GeneID: 700574
NCBI-ProteinID: XP_014967026
Ensembl: ENSMMUG00000016209
Position
12
AA seq 375 aa
MGLRRQIPERGRAANMAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHSSGIVADLSE
QSLKDGEERGEEDPEEEHELPVDMETINLDRDAEDVDLNHCRIGKIEGFEVLKKVKTLCL
RQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKLTR
LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQN
LDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNNKLTMLDIASNR
IKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVML
ALPSVRQIDATFVRF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgggtctgaggcgacagattccggaaaggggaagagcagccaacatggcggcggaacgc
ggcgcggggcagcaacagtcgcaggagatgatggaggttgacaggcgggtcgagtctgaa
gaatccggcgatgaagaagggaagaaacacagcagtggcatcgtggcagacctcagtgaa
cagagcctgaaggatggggaggagcggggggaggaggacccagaagaagaacatgagctg
cctgtggacatggaaaccatcaacctggacagagatgcagaggatgttgatttgaatcac
tgtcgcattgggaagattgaaggatttgaggtactgaagaaagtgaagactctctgcctc
cgccaaaatttaattaaatgcattgagaatctggaggagctacagagtcttcgagagctg
gatctttacgacaaccagatcaagaagattgagaatctggaggcgctaacagagctggag
attctagatatttcttttaatctgctgagaaacatcgaaggggttgacaagttgacacga
ctgaaaaaactcttcttggtcaacaataaaatcagtaaaattgagaacttaagcaactta
catcaactacagatgctagagctgggatctaaccgcatccgggcaattgaaaatattgac
accttaaccaacctggagagtttgtttttggggaaaaacaaaattactaaacttcagaac
ctggatgcgctcaccaacctgacagtcctcagtatgcagagcaaccgactgaccaagatc
gagggtctgcagaacctggtgaacctgcgggagctgtaccttagccacaatggcatcgag
gtcatcgagggcctggagaacaataacaaactcacgatgttggacattgcatcaaataga
atcaaaaagattgaaaatatcagccatctaacagagctgcaagaattctggatgaacgac
aatctccttgagagctggagtgacctcgacgagctgaagggagccaggagcctggagacg
gtgtacttggagcggaaccccctgcagaaggacccccagtacaggcgaaaggtcatgctc
gccctcccctccgtgcggcagattgacgccacgttcgtcaggttctga

DBGET integrated database retrieval system