KEGG   Macaca mulatta (rhesus monkey): 701093
Entry
701093            CDS       T01028                                 
Symbol
CALCR
Name
(RefSeq) calcitonin receptor
  KO
K04576  calcitonin receptor
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04080  Neuroactive ligand-receptor interaction
mcc04380  Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    701093 (CALCR)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    701093 (CALCR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mcc04030]
    701093 (CALCR)
G protein-coupled receptors [BR:mcc04030]
 Secretin receptor family
  Calcium-regulating peptide
   Calcitonin
    701093 (CALCR)
SSDB
Motif
Pfam: 7tm_2 HRM
Other DBs
NCBI-GeneID: 701093
NCBI-ProteinID: XP_014989753
Ensembl: ENSMMUG00000014319
UniProt: F7D5E4
Position
3:112531195..112681747
AA seq 517 aa
MRRTLKLGLLNPWSHTCERPSLLLSCARPPSDRIPGQRDLQKPKMRFAFTCRCFALFLLL
NHPIPILPAFSNQTYPTIEPEPFLYIVGRKKMMDAQYKCYDRMQQLPPYQGEGPYCNRTW
DGWLCWDDTPAGVLSYQFCPDYFPDFDPSEKVTKYCDENGVWFKHPENNRTWSNYTLCNA
FTPEKLKNAYVLYYLAIVGHSLSIFTLVISLGIFVFFKSLGCQRVTLHKNMFLTYILNSM
IIIIHLVEVVPNGELVRRDPVSCKILHFFHQYMMACNYFWMLCEGIYLHTLIVMAVFTEK
QRLRWYYLLGWGFPLVPTTIHAITRAVYFNDNCWLSVETHLLYIIHGPVMAALVVNFFFL
LNIVRVLVTKMRETHEAESHMYLKAVKATMILVPLLGIQFVVFPWRPSNKILGKIYDYVM
HSLIHFQGFFVATIYCFCNNEVQTTVKRQWVQFKIQWNQRWGRRPSSRSARAAAAAEAGD
IRVYICHQEPRNEPANNQGEESVEIIPLNIIEQETSA
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgagacggacgctgaagcttggactcctgaatccctggagccacacctgcgaacgccct
tcgcttctattgagctgtgcccggccgcccagtgacagaattccaggacaaagagatctt
caaaaaccaaaaatgaggttcgcatttacatgccggtgcttcgcactgtttctgcttcta
aatcacccaatcccaattcttcctgccttttcaaatcaaacctatccaacaatagagccc
gagccatttctttacatcgtaggacgaaagaagatgatggatgcacagtacaaatgctat
gaccggatgcagcagttacccccataccaaggagaaggtccatattgcaatcgcacctgg
gatggatggctgtgctgggatgacacaccggctggagtactgtcctatcagttctgccca
gattattttccagattttgatccatcagaaaaggttacaaaatactgtgatgaaaacggc
gtttggtttaaacatcctgaaaacaatcgaacctggtccaactatactttgtgcaatgct
ttcactcctgagaaactgaagaatgcgtatgttctgtactatttggctatcgtgggtcat
tctttgtcaattttcaccttagtgatttccctggggattttcgtgtttttcaagagcctt
ggctgccaaagggtaaccctacacaagaacatgtttcttacttacattctgaattctatg
attatcatcatccacctggttgaagtagtacccaatggagagctcgtgcgaagggacccg
gtgagctgcaagattttgcattttttccaccagtacatgatggcctgcaactatttctgg
atgctctgtgaagggatctatcttcatacactcatcgtcatggccgtgtttactgagaag
caacgcttgcggtggtattatctcttgggctgggggtttccgctggtgccaaccactatc
catgctattaccagggccgtgtacttcaatgacaactgctggctgagtgtggaaacccat
ttgctttacataatccatggccctgtcatggcggcacttgtggtcaatttcttctttttg
ctcaacattgtccgggtgcttgtgaccaaaatgagggaaacccatgaggcggaatcccac
atgtacctgaaggctgtgaaggccaccatgatccttgtgcccctgctgggaatccagttt
gtcgtctttccctggagaccttccaacaagatacttgggaagatatatgattacgtgatg
cactctctgattcatttccagggcttctttgttgcgaccatctactgcttctgcaacaat
gaggtccaaaccaccgtgaagcgccaatgggtccaattcaaaattcaatggaaccagcgc
tgggggaggcgcccctccagccgctcggctcgcgctgcagctgctgcggaggccggcgac
atccgggtttacatctgccatcaggagccgaggaatgaaccagccaacaaccaaggcgag
gagagtgttgagatcatccctttgaatatcatagagcaagaaacatccgcttga

DBGET integrated database retrieval system