KEGG   Macaca mulatta (rhesus monkey): 701464
Entry
701464            CDS       T01028                                 

Gene name
HIST1H2BK
Definition
(RefSeq) histone H2B type 1-K
  KO
K11252  histone H2B
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04613  Neutrophil extracellular trap formation
mcc05034  Alcoholism
mcc05203  Viral carcinogenesis
mcc05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    701464 (HIST1H2BK)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    701464 (HIST1H2BK)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    701464 (HIST1H2BK)
  09165 Substance dependence
   05034 Alcoholism
    701464 (HIST1H2BK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcc03036]
    701464 (HIST1H2BK)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    701464 (HIST1H2BK)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    701464 (HIST1H2BK)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   701464 (HIST1H2BK)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Other DBs
NCBI-GeneID: 701464
NCBI-ProteinID: NP_001247459
Ensembl: ENSMMUG00000041377
UniProt: I0FVV7
Position
4
AA seq 126 aa
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSAK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgccggagccagcgaagtccgctcctgcgcccaagaagggctcgaagaaggcagtgact
aaggcccagaagaaagacggcaagaagcgcaagcgcagccgcaaggagagctactccgtg
tacgtgtacaaggtgctgaagcaggtccaccccgacaccggcatctcctctaaggccatg
ggaatcatgaactccttcgtcaacgacatctttgagcgcattgcgggtgaggcttcccgt
ctggcgcattacaacaagcgctcgaccatcacctccagggagatccagacggccgtgcgc
ctgctgctgcccggcgagctggccaagcacgccgtgtcggagggcaccaaggccgtcacc
aagtacaccagcgctaagtaa

DBGET integrated database retrieval system