KEGG   Macaca mulatta (rhesus monkey): 702028
Entry
702028            CDS       T01028                                 

Gene name
D2HGDH
Definition
(RefSeq) D-2-hydroxyglutarate dehydrogenase, mitochondrial isoform X1
  KO
K18204  D-2-hydroxyglutarate dehydrogenase [EC:1.1.99.39]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    702028 (D2HGDH)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.99  With unknown physiological acceptors
    1.1.99.39  D-2-hydroxyglutarate dehydrogenase
     702028 (D2HGDH)
SSDB
Motif
Pfam: FAD-oxidase_C FAD_binding_4
Other DBs
NCBI-GeneID: 702028
NCBI-ProteinID: XP_014967055
Ensembl: ENSMMUG00000018548
Position
12
AA seq 573 aa
MCIKREIPLGHFQARSQQLPALDPRALSTGLAPKEEPEASVPAAMLPRQLLARPAWLFRC
PPGPRGACAPGAAGSWGRPVGPLARRGCCSAPGTPEVPLTRERYPVRRLPFSTVSEQDLA
AFERIVPGGVVTDPEALQAPNVDWIRTLRGSSKVLLRPRTSEEVSHILRHCHERNLAVNP
QGGNTGMVGGSVPVFDEIILSTARMNKVLSFHSVSGILVCQAGCVLEELSHYVEERDFIM
PLDLGAKGSCHIGGNVATNAGGLRFLRYGSLHGTVLGLEVVLADGTILDCLTSLRKDNTG
YDLKQLFIGSEGTLGVITAVSILCPPKPRAVNVAFLGCPGFAEVLQTFSTCKGMLGEILS
AFEFMDAVCMQLVGRYLHLASPVQESPFYVLIETSGSNAGHDAEKLGSFLEHALGSGLVT
DGTMATDQTKVKMLWALRERIAEALSRDGYVYKYDLSLPVERLYDIVTDVRARLGPHAKH
VVGYGHLGDGNLHLNVTAEAFSPSLLGALEPHVYEWTARQQGSVSAEHGVGFRKRDVLGY
SKPPEALQLMQQLKALLDPKGILNPYKTLPSQA
NT seq 1722 nt   +upstreamnt  +downstreamnt
atgtgcataaaacgtgaaattccccttggccatttccaggcgcgcagccagcagctcccg
gcccttgacccccgggccctgagtaccggcctcgccccgaaggaggagcccgaggcctcc
gtcccggcggcgatgctgccccgtcagctgctggcgcggcccgcgtggttgttccggtgt
cccccggggccgcgcggggcctgtgccccgggagccgcgggttcttggggtcggccggtt
ggccccctggcccgcaggggctgctgctccgcccccgggaccccggaggtgccgctgacc
cgggagcgctaccccgtgcggcgcttgccgttctccacggtgtctgagcaggacctggcc
gcctttgagcgcatcgtgcccggcggggtcgtcacggatccggaggcgctgcaggctccc
aacgtggactggatacggacgctgcgaggctctagcaaggtgctgctgaggccacggacc
tcggaggaggtgtcccacatcctcaggcactgccatgagaggaacctggccgtgaaccca
caggggggcaacacaggcatggtgggtggcagcgtccccgtctttgacgagatcatcctc
tccactgcccgcatgaacaaggtcctcagcttccatagtgtgtctggaattctggtttgc
caggcgggctgcgtcctggaggagctgagccactacgtggaggaacgggactttatcatg
ccactggacttaggagccaagggcagctgccacatcgggggaaacgtggcaaccaacgcc
gggggcctgcggtttcttcgatacggctcactgcatgggactgtcctgggcctggaagtg
gtgttggccgacggcaccatcctggactgcctgacctccctgaggaaggacaacacgggc
tatgacctgaagcagctgttcatcgggtcggagggcactttgggggtcatcactgcggtg
tccatcctgtgtccacccaagcccagggctgtgaacgtggctttcctcggctgtccaggc
tttgctgaggttctgcagaccttcagcacctgcaaggggatgctgggcgagatcctgtct
gcattcgagttcatggatgctgtgtgcatgcaactggtcgggcgttatctccacctggcc
agcccggtacaagagagtccgttttacgtcctcatcgagacttcaggctccaacgcaggc
catgatgctgagaagctgggcagcttcctggagcacgcactgggctctggcctggtgacc
gacgggaccatggccaccgaccagacgaaagtcaagatgctgtgggccctgagggaaagg
atcgcagaggcgctgagccgagacggctacgtgtacaagtacgacctctccctccccgtg
gagcgactctacgacatcgtgactgatgtgcgtgcccgccttggcccacatgccaagcac
gtggtgggctacggccacctgggagatggtaacctgcacctcaatgtgacggcggaggcc
ttcagcccgtcgctcctgggtgccctggagccccacgtgtacgagtggacggccaggcag
cagggcagtgtcagcgcagagcacggcgtgggcttcaggaagagggatgtgctgggctac
agcaagccacccgaggccctgcagctcatgcagcagctcaaggccctgctggaccccaag
ggcatcctcaacccctacaagacgctgcccagccaggcctga

DBGET integrated database retrieval system