KEGG   Macaca mulatta (rhesus monkey): 702695
Entry
702695            CDS       T01028                                 

Gene name
APLN
Definition
(RefSeq) apelin precursor
  KO
K05225  apelin
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04080  Neuroactive ligand-receptor interaction
mcc04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    702695 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    702695 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 702695
NCBI-ProteinID: NP_001177797
UniProt: F7GX01
Position
X
AA seq 77 aa
MNLRLCVQALLLLWLSLTAVCGGPLMQLPYGNGLEEGNVRHLVQPRGSRNGPGPWQGGRR
KFRRQRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatctgcggctctgcgtgcaggcgctcctgctgctctggctctccttgaccgcggtg
tgtggagggcccctgatgcagcttccctatgggaatgggctggaagagggcaatgtccgc
cacctggtgcagcccagagggtcgaggaacgggccagggccctggcagggaggtcgaagg
aaattccgccgccagcggccccgcctctcccataagggacccatgcctttctga

DBGET integrated database retrieval system