KEGG   Macaca mulatta (rhesus monkey): 702837Help
Entry
702837            CDS       T01028                                 

Gene name
MAPK7
Definition
(RefSeq) mitogen-activated protein kinase 7
  KO
K04464  mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04540  Gap junction
mcc04657  IL-17 signaling pathway
mcc04722  Neurotrophin signaling pathway
mcc04912  GnRH signaling pathway
mcc04921  Oxytocin signaling pathway
mcc05206  MicroRNAs in cancer
mcc05418  Fluid shear stress and atherosclerosis
Module
mcc_M00690  MAPK (ERK5) signaling
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    702837 (MAPK7)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    702837 (MAPK7)
 Organismal Systems
  Immune system
   04657 IL-17 signaling pathway
    702837 (MAPK7)
  Endocrine system
   04912 GnRH signaling pathway
    702837 (MAPK7)
   04921 Oxytocin signaling pathway
    702837 (MAPK7)
  Nervous system
   04722 Neurotrophin signaling pathway
    702837 (MAPK7)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    702837 (MAPK7)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    702837 (MAPK7)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     702837 (MAPK7)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   702837 (MAPK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Haspin_kinase Kinase-like APH Rrn6
Motif
Other DBs
NCBI-GeneID: 702837
NCBI-ProteinID: XP_001099721
Ensembl: ENSMMUG00000008536
Position
16
AA seq 816 aa AA seqDB search
MAEPLKEEDGEDGSAEPPGPVKAEPAHTAASVAAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
LPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCPDVEMP
SPWAPSGDCAMESPPPAPPPCPGPGPDTIDLTLQPPPPASEPAPPKKEGAISDNTKAALK
AALLKSLRSRLRDGPSAPLEASEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERER
KERGAGASGGPSTDPLAGLVLSDNDRSLLERWTRMARPPAPAPTSVPAPAPVPTPTPAQP
ASPPPGPVAQPTGPQPQPQPVGSTSGPVPQPACPPPGPAAHPTGPPRPIPVPAPPQIATS
TSLLAPQSLVPPPGLPGSNTPGVLPYFPPGLPPTDAGGAPQSSMSESPDVNLVTQQLSKS
QVEDPLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGVADGPQDGQSDSASLSASLLAD
WLEGHGMNPADIESLQREIQMDSPMLLADLPDLQDP
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcccctgaaggaggaagacggcgaggacggctctgcggaaccccccgggccc
gtgaaggccgaacccgcccacaccgctgcctctgtagcggccaagaacctggccctgctt
aaagcccgctccttcgatgtgacctttgacgtgggcgacgagtacgagatcatcgagacc
ataggcaacggggcctacggagtggtgtcctccgcccgccgccgtctcaccggccagcag
gtggccatcaagaagatccccaatgcttttgatgtggtgaccaatgccaagcgaaccctc
agggagctgaagatcctcaagcactttaagcacgacaacatcatcgccatcaaggacatc
ctgaggcccactgtgccctatggcgaattcaaatctgtctacgtggtcctggacctgatg
gaaagtgacctgcaccagatcatccactcctcacagcccctcacactggaacacgtgcgc
tacttcctgtaccaactgctgcggggcctgaagtacatgcactcggctcaggtcatccac
cgtgacctcaagccctccaacctattggtgaatgagaactgtgagctcaagattggtgac
tttggtatggctcgtggcctgtgcacctcgcccgctgaacatcagtacttcatgaccgag
tatgtggccacgcgctggtaccgtgcccctgagctcatgctctctttgcatgagtataca
caggctattgacctttggtctgtgggctgcatctttggtgagatgctggcccggcgccag
ctcttcccgggcaaaaactatgtacaccagctacagctcatcatgatggtgctgggtacc
ccatcaccagccgtgattcaggctgtgggggctgagagggtgcgggcctatatccagagc
ttgccaccacgccagcctgtgccctgggagacagtgtacccaggtgccgaccgtcaggcc
ctatcactcctgggtcgcatgctgcgttttgagcccagcgcccgcatctcagcagctgct
gcccttcgccaccctttcctggccaagtaccatgatcctgatgatgagcctgactgtgcc
ccgccctttgactttgcctttgatcgtgaagccctcactcgggagcgcattaaggaggcc
atcgtggctgagattgaggacttccatgcaaggcgcgagggcatccgccagcagatccgc
ttccagccttctctccagcctgtggctagtgaacctggctgtccagatgttgaaatgccc
agtccctgggctcccagtggggactgtgccatggagtctcccccaccagccccaccaccg
tgccctggccctggacctgacaccattgatctgaccctgcagccacccccaccagccagt
gagcctgccccaccgaagaaagagggtgccatctcagacaacactaaggctgcccttaaa
gctgccctgctcaagtctttgagaagccggctcagagatggccccagcgcacccctggag
gcttctgagcctcggaagccggtgacagcccaggagcgccagcgggagcgggaggagaag
cggcggcggcggcaagagcgagccaaggagcgggagaaacggcggcaggagcgggagcga
aaggaacggggggccggggcctctgggggcccctccactgaccctttggctggactagtg
ctcagcgacaatgacagaagccttttggaacgctggactcgaatggcccgacccccagcc
ccagccccgacctctgtgccagcccctgccccagtgccaacgccaaccccagcccaacct
gccagtcctcctcctggccctgtagcccagcccactggcccacaaccacaaccacaacct
gtgggctccacatctggccctgtaccccagcctgcctgcccaccccctggccctgcagcc
caccccaccggccctcctaggcccatccctgtccctgcgccaccccagattgccacctct
accagcctcctggctccccagtcacttgtgccaccccctgggttgcctggctccaacacc
ccaggagttttgccttacttcccacctggcctgccacctacagacgccgggggagcccct
cagtcttccatgtcagagtcacctgatgtcaacctagtgacccagcagctatctaagtca
caggtggaggaccccctgccccctgtgttctcaggcacaccaaagggcagtggggctggc
tacggtgttggctttgacctggaggaattcttaaaccagtctttcgacatgggcgtggct
gatgggccacaggatggccagtcagattcagcctcactctcagcctccctgcttgctgac
tggcttgaaggccatggcatgaaccctgccgatattgagtccctgcagcgtgagatccag
atggactctccaatgctgctggctgacctgcctgacctccaggacccctga

DBGET integrated database retrieval system