KEGG   Macaca mulatta (rhesus monkey): 702954Help
Entry
702954            CDS       T01028                                 

Gene name
CYP2A26
Definition
(RefSeq) cytochrome P450, family 2, subfamily A, polypeptide 6 precursor
  KO
K07411  cytochrome P450 family 2 subfamily A [EC:1.14.14.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00830  Retinol metabolism
mcc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    702954 (CYP2A26)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mcc00199]
    702954 (CYP2A26)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     702954 (CYP2A26)
Cytochrome P450 [BR:mcc00199]
 Cytochrome P450, animal type
  CYP2 family
   702954 (CYP2A26)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 702954
NCBI-ProteinID: NP_001191360
Ensembl: ENSMMUG00000046274
UniProt: E0XJT3
Position
19
AA seq 494 aa AA seqDB search
MLASGLLLVALLACLTVMVLMSVWQQRNSKGKLPPGPTPLPFIGNYLQLNTEQMYNSIMK
ISERYGPVFTIHLGPRRVVVLCGYDAVKEALVDQAEEFSGRGEQATFNWVFKGYGVAFSN
GERAKQLRRFSIATLRDFGVGKRGIEERIQEEADFLIKALRGTHGANIDPTFFLSRTVCN
VISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTSTSMGQLHEMFSSVMKHLPGPQQQAFKE
LQGLEDFIAKKVEHNQRTLDPNSPRDFIDSFLIRMQEEEKNPNTEFYMQNLLMTALNLFI
AGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVISKNRQPKFEDRVKMPYMEAVIHEIQ
RFGNVIPMSLARRVNKDTKFRDFFLPKSTEVFPMLGSVLKDPKFFSNPQDFNPQHFLDEK
GQFKKSDAFVPFSIGKRNCFGEGLARMELFLFFTTIMQNFRFKSPQSPKDIDVSPKHVGF
ATIPPNYTMSFLPR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgctggcctcagggctgctcctggtggccttgctggcctgcctgactgtgatggtcttg
atgtctgtctggcagcagaggaacagcaagggaaagctgcctccgggacccaccccattg
cccttcattggaaactacctgcagctgaacacagagcagatgtacaactccatcatgaag
atcagtgagcgctatggcccggtgttcaccattcacctggggccccggcgggtggtggtg
ctgtgcggatatgatgccgtcaaggaggctctggtggaccaggctgaggagttcagcggg
cgaggcgagcaggccaccttcaactgggtcttcaaaggctatggcgtggcgttcagcaac
ggggagcgcgccaagcagctccggcgcttctccatcgccaccttgcgggacttcggggtg
ggcaagcgcggcatcgaggagcgcatccaggaggaggcggatttcctcatcaaggccctc
cggggcacgcatggcgccaatatcgatcccaccttcttcctgagccgcaccgtctgtaat
gtcatcagctccattgtctttggggaccgctttgactatgaggacaaagagttcctgtca
ctgctgcgcatgatgctgggaagcttccagttcacgtcaacctccatggggcagctccat
gagatgttctcttcggtgatgaaacacctgccaggaccacagcaacaggcctttaaggag
ctgcaagggctggaggacttcatagccaagaaggtggagcacaaccagcgcacactggat
cccaactccccacgggacttcatcgactcctttctcatccgcatgcaggaggaggagaag
aaccccaacacggagttctacatgcagaacctgttgatgaccgcgctgaacctcttcatt
gcaggcaccgagaccgtcagcaccaccctgcgctacggcttcctgctgctcatgaagcac
ccagaggtggaggccaaggtccatgaggagattgacagagtgatcagcaagaaccggcag
cccaagtttgaggaccgggtcaagatgccctacatggaggcagtgatccatgagatccaa
agatttggaaacgtgatccccatgagtttggcccgcagggtcaacaaggacaccaagttt
cgcgatttcttcctccctaagagcaccgaagtgttccctatgctgggctccgtgctgaaa
gaccccaagttcttctccaacccccaggacttcaatccccagcacttcttggatgagaag
gggcagtttaagaagagcgatgcttttgtgcccttttcaatcggaaagcggaactgtttc
ggagaaggcctggccagaatggagctctttctcttcttcaccaccatcatgcagaacttc
cgcttcaagtccccccagtcgcccaaggacatcgacgtgtcccccaaacacgtgggcttt
gccacgatcccaccaaactacaccatgagcttcctgccccgctga

DBGET integrated database retrieval system