KEGG   Macaca mulatta (rhesus monkey): 703356Help
Entry
703356            CDS       T01028                                 

Gene name
PRKG1
Definition
(RefSeq) protein kinase, cGMP-dependent, type I
  KO
K07376  cGMP-dependent protein kinase 1 [EC:2.7.11.12]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04022  cGMP-PKG signaling pathway
mcc04270  Vascular smooth muscle contraction
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04713  Circadian entrainment
mcc04714  Thermogenesis
mcc04730  Long-term depression
mcc04740  Olfactory transduction
mcc04923  Regulation of lipolysis in adipocytes
mcc04970  Salivary secretion
Module
mcc_M00694  cGMP signaling
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    703356 (PRKG1)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    703356 (PRKG1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    703356 (PRKG1)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    703356 (PRKG1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    703356 (PRKG1)
  Digestive system
   04970 Salivary secretion
    703356 (PRKG1)
  Nervous system
   04730 Long-term depression
    703356 (PRKG1)
  Sensory system
   04740 Olfactory transduction
    703356 (PRKG1)
  Environmental adaptation
   04713 Circadian entrainment
    703356 (PRKG1)
   04714 Thermogenesis
    703356 (PRKG1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     703356 (PRKG1)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: AGC group
  PKG family
   703356 (PRKG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase cNMP_binding Pkinase_Tyr PKcGMP_CC Kinase-like Wtap APH Pkinase_C Atg14 Tnp_22_trimer Med4 OmpH IncA
Motif
Other DBs
NCBI-GeneID: 703356
NCBI-ProteinID: XP_001099261
Ensembl: ENSMMUG00000010844
UniProt: F7G3M3
Position
9
AA seq 671 aa AA seqDB search
MSELEEDFAKILMLKEERIKELEKRLSEKEEEIQELKRKLHKCQSVLPVPSTHIGPRTTR
AQGISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMY
PVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTAT
VKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEET
HYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDV
RTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSDF
NIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDF
IVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGI
IYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISAD
YWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPS
ERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPP
PDDNSGWDIDF
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagctagaggaagactttgccaagattctcatgctcaaggaggagaggatcaaa
gagctggagaagcgtctgtcagagaaggaggaggaaattcaggagctgaagaggaaactc
cacaaatgccagtcggtgcttcccgtgccctcgacccacatcggcccccggaccacccgg
gcgcagggcatctcggccgagccgcagacgtacaggtccttccacgacctccgacaggca
ttccggaagttcaccaagtccgaaaggtccaaggatcttataaaggaagctatccttgat
aatgactttatgaagaacttggagctgtcgcagatccaggagattgtggattgtatgtac
ccggtggagtatggcaaggacagttgcatcatcaaagaaggagatgtgggatcactggtg
tatgtcatggaagatggtaaggttgaagttacaaaagaaggtgtgaagttgtgtaccatg
ggtccaggaaaagtgtttggggagttggctattctttacaactgtacccggacagcgacc
gtcaagactcttgtaaatgtaaaactctgggccattgatcgacaatgttttcaaacaata
atgatgaggacaggactcatcaagcataccgagtatatggaatttttaaaaagtgttcca
acattccagagccttcctgaagagatcctcagcaagctcgctgatgtccttgaagagacc
cactatgaaaatggagaatatattatcaggcaaggtgcaagaggggacaccttcttcatc
atcagcaaaggaacggtaaatgtcactcgtgaagactcaccaagtgaagacccagtcttt
cttagaactttaggaaaaggagactggtttggagagaaagccttgcagggggaagatgtg
agaacagcaaatgtaattgctgcagaagctgtaacctgccttgtgattgacagagactct
ttcaaacatttgattggagggctggatgatgtttctaataaagcatatgaagatgcagaa
gctaaagcaaaatatgaagctgaagcggctttcttcgccaacctgaagctgtctgatttc
aacatcattgatacccttggagttggaggtttcggacgagtagaactggtccagttgaaa
agtgaagaatccaaaacatttgcaatgaagattctcaagaaacgtcacattgtggacaca
agacagcaggagcacatccgctcagagaagcagatcatgcagggggctcattccgatttc
atagtgagactgtacagaacatttaaggacagcaaatatttgtatatgttgatggaagct
tgtctaggtggagagctctggaccattctcagggatagaggttcgtttgaagattctaca
accagattttacacagcatgtgtggtagaagcttttgcctatctgcattccaaaggaatc
atttacagggacctcaagccagaaaatctcatcctagatcaccgaggttatgccaaactg
gttgattttggctttgcaaagaaaataggatttggaaagaaaacatggactttttgtggg
actccagagtatgtagccccagagatcatcctgaacaaaggccatgacatttcagccgac
tactggtcactgggaatcctaatgtatgaactcctgactggcagcccacctttctcaggc
ccagatcctatgaaaacctataacatcatattgagggggattgacatgatagaatttcca
aagaagattgctaaaaatgctgctaatttaattaaaaaactatgcagggacaatccatca
gaaagattagggaatttgaaaaatggagtaaaagacattcaaaagcacaaatggtttgag
ggctttaactgggaaggcttaagaaaaggtaccttgacacctcctataataccaagtgtt
gcatcacccacagatacaagcaattttgacagttttcctgaggacaacgatgaaccacca
cctgatgacaactcaggatgggacatagacttctaa

DBGET integrated database retrieval system