KEGG   Macaca mulatta (rhesus monkey): 703527Help
Entry
703527            CDS       T01028                                 

Gene name
TTN
Definition
(RefSeq) titin isoform X2
  KO
K12567  titin [EC:2.7.11.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc05410  Hypertrophic cardiomyopathy (HCM)
mcc05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    703527 (TTN)
   05414 Dilated cardiomyopathy (DCM)
    703527 (TTN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    703527 (TTN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    703527 (TTN)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcc04812]
    703527 (TTN)
   04147 Exosome [BR:mcc04147]
    703527 (TTN)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     703527 (TTN)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   703527 (TTN)
Membrane trafficking [BR:mcc04131]
 Others
  Actin-binding proteins
   Others
    703527 (TTN)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     703527 (TTN)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   703527 (TTN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 I-set Ig_3 ig Ig_2 Pur_ac_phosph_N fn3_2 V-set C2-set_2 Titin_Z Pkinase fn3_4 Tissue_fac Receptor_2B4 Pkinase_Tyr DUF2369 SusE Ig_6 Izumo-Ig Ig_4 C1-set Kelch_1
Motif
Other DBs
NCBI-GeneID: 703527
NCBI-ProteinID: XP_014965943
Position
12
AA seq 26974 aa AA seqDB search
MTTQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWIRDGQVISTSTLPGVQISFSD
GRAKLTIPAVTKANSGRYSLRATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQ
VRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGELYSLLIAEAYPEDSGTYSVNATN
SVGRATSTAELLVQGEEEVPAKKTKTIVSTAQISESRQTRIEKKIEAHFDARSIATVEMV
IDGAAGQQLPHKTPPRIPPKPKSRSPTPPSIAAKAQLARQQSPSPIRHSPSPVRHVRAPT
PSPVRSVSPAARISTSPIRSVRSPLLTRKTQASTMATGPEVPPPWKQEGYVASSSEAEMR
ETRLTTSTQIRTEERWEGRYGIQEQMTISGAAGAAASVSASATYAAEAVATGAKEVKQDA
DKSAAVATVVAAVDMARVREPVISAVEQTAQRTTTTAVHVQPAQEQQVRKEAEKTAVTKV
VVAADKAKEQELKSRTREVITTKQEQMHVTHEQIRKETEKTFVPKVVISAAKAKEQETRI
SGEITTKQKQVTQETIRQETEITAASMVVVATAKSTKLETVPGAQEETATQQDQMHLSHE
KIMKETRKTVVPKVIVATPKVKEQDLVSRSREGITTKREQVQITQEKMRKEAEKTALSTI
AVATAKAKEQETILRTRETMATRQEQTQVTHGKVDVGKKAEAVATVVAAVDQARVREPRE
PGRLEESYAQQTTLEYGYKERISAAKVAEPPQRPASEPHVVPKAVKPVVIQAPSETHIKT
TDQMGMHISSQIKKTTDLTTERLVHVDKRPRTASPHFTVSKISVPKTEHGYEASIAGSAI
ATLQKELSATSSAQKITKSVKAPTVKPSETRVRAEPTPSPQFPFADTPDTYKSQAGVEVK
KEVGVSITGATVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVSGLKNVTVIEGES
VTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVN
EAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSITEEQAGPGEP
AAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGEC
KLVISMTFADDAGEYTIVIRNKHGETSASASLLEEADYESLMKSQQEMLYQTQVTAFVQE
PKVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVMVRTYVEDQEFHISSFEERLIKEIE
YRIIKTTLEELLEEDGEEKMAVDISESEAVESGFELRIKNYRILEGMGVTFHCKMSGYPL
PKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKL
YVEPAAPLGAPTYIPTPEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMSPARMSP
GRRLEETDESQLERLYKPVFVLKPASFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVN
DYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFV
EKLKNLNVKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDS
TVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEP
LHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWL
HDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKS
LVEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLFPEPVRVLEGETAR
FRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHYLDIVDCKSYDTGEVKVTAENPEG
VIEHKVKLEIQQREDFRSVLRRAPEPRPEFHVHEPGKLQFEVQKVDRPVDTTETKEVVKL
KRAERITHEKVPEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTKDELL
HWTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRV
RVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGE
TSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDK
YRMHSDRKVHFLSILTIDMSDAEDYSCVLVEDENIKTTAKLIVEGAVVEFVKELEDIEVP
ESYSGELECIVSPENIEGKWYHNNVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFV
IDGKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSD
RIHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEG
TKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVHAIVKGTKQRLVINRTHASDEGPYKLIV
GRVETNCNLSVEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYK
IEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAISKPLTDQTVAESQEAVF
ECEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATSKTS
AKLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKG
TVYSLRIKNCAIVDESVYGFRLGRLGASARLHVETVKIIKKPKDVTALENATVAFEVSVS
HDTVPVKWFHKNVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFV
ETLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLI
IMNTSTEDSAEYTFVCGNDQVSATLTVTPIMITSMLKDINAEEKDTITFEVTVNYEGISY
KWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIE
FRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPST
RMSDAGKYTVVAGGNVSTANLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHW
YKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPP
QVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLI
EAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEIVSPDQEMPVYPPAIITPLQDTVTSEG
QPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVAS
NAVGQVSSTANLSLEAPESILHERIEQEIEMEMKEFASSFLSAEEEELHSSELHLSNINE
TLELLSEPPVYSTKFDSKKEGAVPVFIKEVSSADTSMGDVATLSVTVIGIPKPKIQWFFN
GVPLTPSADYKFVFDGDDHSLIILFTTLEDEGEYTCMASNDYGQAICSAYLKINSKGEGH
KDTETESAVAKSLEKLGGPCPPHFLKELKAVRCAQGLPAIFEYTVVGEPAPTVAWFKENK
QLCTSVYYTIIHNPDGSGTFIVNDPQREDSGLYICKAENMLGESTCAAELLVLLEDTDMT
DTPCKAKSTPEAPEDFSQTPLKGPAVEAVDSEQEIATFVKDTILQASLITEENQQLSYEH
IAKANELSSQLPLGAQELQSILKQDKSTPESTREFLCINGSTHFQPLKEPSPNLQLQTVQ
SQKTFSKESILMLEEPETQAVLSETEKIFPSAMFIEQINSLTVEPLKTVLTEPEGNYPQS
SIEPPVHSYLTSVAEEVLLPKEKTVSDANKDQRVTLQKQEAQSALILSQSLAEGHVESLQ
SPDVMISQVNYEPLVPSEHSCTEGAEILIESADPLENAGQDSAVRIEEGKSLRFPLALEE
KQVLLKEEHSDNVVMPPDQIIESKREPVAIKKVQEVQGRDILSKESLLSGIPEEQRLNLK
IQIRRALQAAVASEQPGLFSEWLRNIEKVEVMAVNITQEPRHIMCTYLVTSAKSITEEVT
IIIEDVDPQITNLKMELKDVLCAIIYEEISILTAEGPRIQQGAKTSLQEEMDSFSGSQKV
EPITEPEVESKYLISTEEVRYFNMQSQVKYLDATTVTNGVASAVVSDEKQDESLKPSEEK
EESSSESGTEEVGTVKIQEPEGGLIKEDGPVIHTPLMDTVSEEGDIVHLTTSITNAKEVN
WYFENKLVPSDEKFKCLQDQNTYTLVIDKVNTEDHQGEYVCEALNDNGKTATSAKLTVVK
RAAPVIRRRIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYVSS
LEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTVPGGEKKVRKLLPERKPEPKEEVVLK
SVLRKRPEEEEPKVEPKKLEKVKKPAVPEPPPPKPVEEVEVPTVTKRERKIPEPTKVPEI
KPAIPLPGPEPKPKPEAEVKTIKPPPVEPEPTPIAAPVTVPVVGKKAEAKAPKEEAAKPK
GPIKGVAKKTPSPIEAERRKLRPGSGGEKPPDEAPFTYQLKAVPLKFVKEIKDIVLTESE
FVGSSAIFECLVSPSTAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTC
VLRLGNKEKTSTAKLVVEELPVRFVKTLEEEVTVVKGQPLYLSCELNKERDVVWRKDGKI
VVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWLVK
PIRDQHVKPKGTAIFACDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAM
PEDIDEYAVEIEGKRYPAKLTLGEREVELLKPIEDVTIYEKESASFDAEISEADIPGQWK
LKGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAITTAILTVKEIELDFAV
PLKDVTVPERRQARFECVLTREANVIWSKGPDIIKSSDKFDIIADGKKHILVINDSQFDD
EGVYTAEVEGKKTSARLFVTGIRLKFMSPLEDQTVKEGETATFVCELSHEKMHVVWFKND
VKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQVKDLSSTAQLKVLEADPYFTVKLH
DKTAVEKDEIILKCELSKDVPVKWFKDGEEIVPSPKYSIKADGLRRILKIKKAELKDKGE
YVCDCGTDKTKANVTVEARLIKVEKPLYGVEVFVGETARFEIELSEPDVHGQWKLKGEPL
TASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAANLKVKELPLIFITPLSDVK
VFEKDEAKFECEVSREPKTFRWLKGTQEITGDDRIELIKDGTKHSMVIKSAAFEDEAKYM
FEAEDKHTSGKLIIEGIRLKFLTPLKDVTAKEKESAVFTVELSHDNIRVKWFKNDQRLHT
TRSVSMQDEGKTHSITFKDLSIDDTSQIRVEAMGMSSEAKLTVLEGDPYFTGKLQDYTGV
EKDEVILQCEISKADAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCD
CGTDKTSGKLDIEDREIKLVRPLHSVEVMETETARFETEISEDDIHANWKLKGEALLQTP
DCEIKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAG
ETATFDCELSYEDIPVEWYLKGKKLEPSDKVVTRSEGKVHTLTLRDVKLEDAGEVQLTAK
DFKTHANLFVKEPPVEFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKY
EIVADGRVRKLIIHGCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVREKEM
ARFECELSRENAKVQWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTA
RTSGMLTVLEEEAVFTKNLANIEVSETDTIKLVCEVSKPGAEVIWYKGDEEIIETGRYEI
LTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEILEGEKAE
FVCSISKESFPVQWKRDDKILESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARA
AAHLTVIEKLRIVVPLKDTRVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQK
DLVYTLRIRDARLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKS
VTFWCKVNRLNVTLKWTKNGEEVPFDNRVSYRIDKYKHSLTIKDCGFPDEGEYIVTAGQD
KSVAELLIIEAPTEFVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKF
EKDGSIHRLIIKDCRLDDECEYACGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGADVV
FLAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEA
RAKLELAAAPKIKTGDQDLVVDVGQPLTMVVPYDAYPKAEAEWFKENEPLSTKTIDTTAE
QTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDGEVSLAW
EEPLTDGGSKIIGYVVERRDIKRKTWVLATDRADSCEFTVTGLQKGGVEYLFRVSARNRV
GTGEPVETDIPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELR
DKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIE
RPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPVLGYIIERCEEGKDNWIRCNKKLVPELT
YKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTMDLSAFKDGLEVIVPN
PIKILVPSTGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLE
NRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVS
RKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSAPATVPDP
PENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACGEPVAETKMEVTG
LEEGKWYAYRVKALNRQGASKPSKPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIEL
PATVTGKPEPKITWTKADTILKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCG
RATAVVEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVW
HKLSSTVKDTNFKATKLIPNKEYIFRVAAENMYGVGEPVQASPITAKYQFDPPGPPTRLE
PSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNK
KKYRFRVLAENLAGPGKPSKSTEPILIKDPIDPPWPPGKPTVKDVGKTSLRLNWTKPEHD
GGAKIESYIIEMLKTGTDEWVRVAEGVPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSE
PSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGW
QTVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPPYAL
AVVDVTKRHVDLKWEPPKNDGGRPIQRYIIEKKERLGTRWVKAGKTAGPDCNFRVTDVIE
GTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPPEK
NGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAIGVSE
PSEISENVVAKDPDCKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKAS
DRLTMKNDHISAHLEVPKSVHADAGVYTITLENKLGSATASINVKVIGLPGPCKDIKASD
ITKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLIPNGEYF
FRVKAVNKIGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTITWKPPLYDGGSK
IMGYIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQFRVRAENAAGISEPSRATP
PTKAVDPIDAPKVILRTSLEVKRGDEIALDASISGSPYPTITWIKDENAIVPEEIKKRAA
PLVRRRKGEVQEEEPFVLPLTQRLSIDNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIA
KAPCTVSVLDTPGPPINFVFEDIRKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEW
IVVTSTLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKPLVAKDPFEPPDAPDKPI
VEDVTSNSMLVKWNEPKDNGSPILGYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEGL
TYVFRVCAENAAGPGKFSPPSDPKTAHDPISPPGPPIPRVTDTSSTTIELEWEPPAFNGG
GEIIGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNVAGEGPPGET
EPVTVAEPQEPPTVELDVSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDRV
VIDNVGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNR
KMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQPIETERSKCDITGLLEGQEYKFRVI
AKNKFGCGPPVEIGPILAVDPLGPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYI
IEKRRHDKPDFERVNKRLCPTTSLLVENLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQD
DEVPPTIKLRLSVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTEALQITK
EEVSRSEAKTELSIPKAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNLAVTDIK
AESCYLTWDAPLDNGGSEITHYVIDKRDASRKKTEWEEVTNTAVEKRYGIWKLIPNGQYE
FRVRAVNKYGISDECKSDKVVIQDPYRLPGPPGKPKVLARTKGSMLVSWTPPLDNGGSPI
TGYWLEKREEGSPYWSRVSRAPVTKVGLKGVEFNVPRLIEGVKYQFRAMAINAAGIGPPS
EPSDPEVAGDPIFPPGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTD
WKRVNEPDKLITTCECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEV
FIDIGAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDSQLETA
ENSSVIIIPECKRSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDITRGSCRL
SWKMPDDDGGDRIKGYVIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAENR
FGIGPPVETIQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVEC
LAWDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGQYEFRVKAVNAAGVSKPSATVGPVT
VKDQTCPPSIDLTEFMEVEEGTDVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHV
NKLVVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESVS
AEQMTLSWLPPKDDGGSKITNYVIEKREANRKTWVRVSSEPKECTYTIPKLLEGHEYVFR
IMAQNKYGIGEPLDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTG
YWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPS
DPVTARDPIAPPGPPFPKVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKG
KDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVLPDLQLDASV
RDRIVVHAGGVIRIIAYVSGKPPPTVTWNMNERALPQEATIETTAISSSMVIKNCQRSHQ
GVYSLLAKNEAGERKKTIIVDVLDVPGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITN
YVIEKRESDRRAWTPVTYTVTRQNATVQGLIQGKAYFFRVAAENSIGMGPFVETSEALVI
REPITVPERPEDLEVKEVTKSTVTLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTNDN
LLSRKYTVKDLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHLDFRDKLTI
RVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPTTLALEKIKAKRSDSGKYC
VVVENSTGSRKGFCQVNVVDRPGPPVGPVIFDEVTKDYMVISWKPPLDDGGSEITNYIIE
KKEVGKDVWMPVTSASAKTTCKVSKLLEGKDYIFRIHAENLYGISDPLVSDSMKAKDRFR
VPDAPDQPIVTEVTRDTALVTWNKPHDGGKPITNYILEKRETMSKRWARVTKDPIHPYTK
FRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSVD
LTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLRDGQTYKFRVL
AVNEAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIKVGDTLRLSAIIKGVPFPKV
TWKKEDRDAPTKARIDVTPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKP
GPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDVASAQWSSLSATSKKKSHLA
KHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHPPGPPKNLHHVDVDKTEVSLVW
NKPDRDGGSPITGYLVEYQEEGTEDWIKFKTVTNLECVVTGLQQGKTYRFRVKAENIVGL
GLPDTTIPIECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSE
IKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGP
IHILDVTPEHMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQK
GCEYVFRVKAENKIGVGPPLDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSD
GGSPITGYYVERREVTGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSNPSP
SSDPIKACRPIKPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQW
NRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVEL
DVTCRDVITVRVGQTIRILARVKGRPAPDITWTKEGKVLVREKRVDIIQDLPRVELQIKE
AVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLKVTNVTKENCTISWENPLDNGG
SEITNFIVEYRKPNQKGWSIVASDVTKRLIKANLLANNEYYFRVCAENKVGVGPTIETKT
PILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERV
HKGSIKETHYMVDRCVENQIYEFRVQTKNEGGESDWVKTEEVVVKEDLQKPVLDLKLSGV
LTVKAGDTIRLEAGVRGKPFPEVSWTKDKDATDFTRSPRVKIDTSADSSKFSLTKAKRSD
GGKYVVTATNTAGSFVAYATVNVLDKPGPVRNLKIVDVSSDRCTVRWDPPEDDGGCEIQN
YILEKCETKRMVWSTYSATVLTPGTTVTRLIEGNEYIFRVRAENKIGTGPPTESKPVIAK
TKYNKPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAI
PERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIEPPGPPTNFRVVDTTK
HSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTVTSLDEN
QEYEFRVCAQNQVGIGRPAELKEAIKPKEILEPPEIDLDASMRKLVIVRAGCPIRLFAIV
RGRPAPKVTWRKVGIDNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVF
VNVRVLDTPGPVSDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREADRKTWSTVTP
EVKKTSFQVTNLVPGNEYYFRVTAVNEYGPGVPTDVPKPVLASDPLSEPDPPRKLEVTEM
TKNSATLAWLPPLRDGGAKIDGYIISYREEEQPADRWTEYSVVKDLSLVVTGLKEGKKYK
FRVAARNAVGVSLPREAEGVYEAKEQLLPPKILMPEQITIKAGKKLRIEAHVYGKPHPTC
KWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMD
APGPPQPPFDISDIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTS
CRVGKLIPGQEYIFRVRAENRFGISEPLTSPKMVAEFPFGVPSEPKNARVTKVNKDCIFV
AWDRPDSDGGSPITGYLIERKERNSLLWVKANDTPVRSTEYPCAGLIEGLEYSFRIYALN
KAGSSPPSKPTEYVTARMPVDPPGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACK
LPGDKWVRCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAEN
VPPRIDLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNL
CTLELFSVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWE
PPLEDGGSEITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGV
GDPVFTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQ
AVNWTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPPG
PPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTRFE
VTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLILRAGVT
MRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYILTLEN
SCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRDAER
KSWSTVTTECSKTSFRVSNLEEGKSYFFRVFAENEYGIGDPGETRDAVKASQTPGPVVDL
KVRSVTKSSCSIGWKKPHSDGGSRIIGYVVDFLTEENKWQRVMKSLSLQYSAKDLTEGKE
YTFRVSAENENGEGTPSEITVVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKP
APSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISI
KVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVTCASAV
QKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAPPPPNIVEVRHD
SVSLTWTDPRRTGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLTEGLEYEFRV
MAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINVTRNSVTLIWTEPKYDGGHKLTGYIV
EKRDLPSKSWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTGTIICK
DEYEAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITS
TPTSSMLTIKYATRKDAGEYTITATNPFGTKEEHVKVTVLDVPGPPGPIEISNVSAEKAT
LTWTPPLEDGGSPIKSYILEKRETSRLLWTVVSEDIQSCRHVATKLIQGNEYVFRVSAVN
HYGKGEPVQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVER
REKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASNSVLMKDAA
YPPGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTALRI
TQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIVEREMAPDFELDAELRRTLVVRA
GLSIRIFVPIKGRPAPEVTWTKDNINLKNRANIENTESFTLLIIPECNRYDTGKFVMTIE
NPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREAT
RKSYSTVTTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPRETTEPVKASEAPSPPDT
LNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWTHITTVKGLECVVRNLTEG
EEYTFQVMAVNSAGRSAPRESRPVIVKEQTMLPELDLRGIYQKLVIARAGDNIKVEIPVL
GRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARNIVGEVGDV
ITIQVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVELA
TTVIRTTYKATRLTTGLEYQFRVKAQNRYGVGPGITSACIVANYPFKVPGPPGTPQVTAV
TKDSMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVPGNIFKSSGLTDGIAYE
FRVIAENMAGKSKPSKPSEPMLALDPIDPPGKPIPLNITRHTVTLKWAKPEYTGGFKITS
YIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAI
TCRDDIEAPKIKVDVKFKDTVILKAGETFRLEADVSGRPPPTMEWTKDGKELEGTAKLEI
KIADFSTHLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGPPEGPLAVTEVTSE
KCVLSWLPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKLKVTKLLKGNEYIFRVM
AVNKYGVGEPLESEPVLAVNPYGPPDPPKNPEVTAITKDSMVVCWGHPDSDGGSEIINYI
VERRDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPSPTSPFYKAC
DTVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQIVTPPAG
LKATSYTITGLTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRMLPPEIELDADLRKVV
TIRACCTLRLFVPIKGRPAPEVKWAREHGESLDKASIESTSSYTLLIVGNVNRFDSGKYI
LTVENSSGSKSAFVNVRVLDTPGPPQNLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEK
RESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASERPL
PPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQSKGSDKWATCATVKVTEATITG
LIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLKVDVP
FIGRPTPAVIWHKDDVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAT
ETLNVIVLDKPGPPTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQI
VSATVARTTIKACRLKTGCEYQFRIAAENRYGKSTYLNSEPIVAQYPFKVPGPPGTPLVT
LSSRDSMEVQWNEPVSDGGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGVE
YEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIIVTRNSVTLQWKKPTYDGGSKI
TGYIVEKKELPEGRWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTG
AITARDEVDPPRISMDPKYKDTIVVHAGESFKIDADIYGKPIPTIQWIKGDQELSNTARL
EIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPVVISGVT
AEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTLSCKVTKLLEGNEYTFR
IMAVNKYGVGEPLESEPVIAKNPFVVPDAPKAPEVTTVTKDSMIVVWERPASDGGSEILG
YVLEKRDKEGIRWTRCHKRLIGELRLRVTGLLENHNYEFRVSAENAAGLSEPSPPSAYQK
ACDPIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPP
TGINKTNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDLDLELRK
IINIRAGGSLRLFVPIKGRPTPEVKWGKMDGEIRDAAIIDVTSSFTSLVLDNVNRYDSGK
YTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIV
EKREATRKSYAAVVTNCHKNSWKIDELQEGCSYYFRVTAENEYGIGLPAQTADPIKVAEV
PQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECARVKSLEAVI
SNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAFSSYSVQVGQDLKIE
VPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGIMVANIVGQ
KTASIEIVTLDKPDPPKGPVKFDDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVW
DVVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALESDPIVAQYPYKEPGPPGTPF
ATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEEG
IEYEFRVYAENIVGVGKASKNSECYVARDPCDPPGTPEPIMVKRNEITLQWTKPVYDGGS
MITGYIVEKRDLPDGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDS
TGPITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESA
RCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTG
VTSEKCSLTWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYI
FRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEI
IGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPATVY
YKACDPVFKPGPPTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEICKADEEEWQIVT
PQTGLRVTRFEISKLTEHQEYKIRVCALNKVGLGEATSVPGTVKPEDKLEAPELDLDSEL
RKGIVVRAGGSARIHIPFKGRPTPEITWSREEGEFTDKVQIEKGVNYTQLSIDNCDRNDA
GKYILKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVRKDSVLLVWEPPIIDGGAKVKNY
VIDKRESTRKAYANVSSKCSKTSFKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAA
EPPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRILGYVVEMQPKGTEKWSIVAESKVCNA
VVTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYSIQAGEDLK
IEIPVIGRPRPNVSWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTITATNSA
GTATENLSVIVLEKPGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTT
TWHMVSATVARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSKPVIVQYPFKEPGPPGT
PFVTSISKDQMLVHWHEPVHDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLD
EGLEYEFKVSAENIVGIGKPSKVSECYIARDPCDPPGRPEAIVITRNNVTLKWKKPAYDG
GSKITGYLVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPS
ESSGAITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEE
TAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDRPGPPEGPLK
VTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEVQALNYKVTKLLPGN
EYIFRVMAVNKYGIGEPLESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGG
AEIEGYILEKRDKEGVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEP
SVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWT
TCTPPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELD
ADLRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTSSFTMLVIDNVTR
FDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTVREVKKDSVMLSWEPPLIDGGAKI
TNYIVEKRETTRKAYATVTNNCTKTTFRIENLQEGCSYYFRVLASNEYGIGLPAETTEPV
KVSEPPLPPGRVTLVDVTHNTATIKWEKPESDGGSKIIGYVVEMQTKGSEKWSTCTQVKT
LEATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELPFHTFNVKARE
QLKIDVPFKGRPQATVNWKKDGQTLKETTRVNVSSSKTVTSLSIKEASREDVGTYELCVS
NSAGSITVPLTIIVLDRPGPPGPIHIDEVSCDNITISWNPPEYDGGCQISNYIVEKRETT
STTWHTVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVAEYPFSPPGPP
GTPKVVHATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWSKANKILIADTQMKVSG
LDEGLMYEYRVYAENIAGIGKCSKSCEPVPARDPCDPPGQPEVTNITRKSVSLKWSKPHY
DGGAKITGYIVERRELPDGRWLKCNYTNIQETHFEVTELTEDQRYEFRVFAKNAADSISE
PSESTGPITVKDDVEAPRIMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGVEI
EERARTEIISTDNHTLLTVKDCVRRDTGQYVLTLKNVAGTRSVAINCKVLDKPGPPAGPL
EINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWTICEGELRTTSCKVTKLLKG
NEYIFRVTGVNKYGVGEPLESVAVKALDPFTVPSPPTSLEITSVTKESMTLCWSRPESDG
GSEISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSE
TSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDW
KTAIQSLRGTEYTISGLTTGAEYIFRVRSVNKVGASDPSDSSDPQIAKEREEEPVFDIDS
EMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDLRTRAYIDTTDSRTSLTIENANRN
DSGKYTLTIQNVLSAASLTLVVKVLDSPGPPTNIAVQDVTKESAVLSWDVPENDGGAPVK
NYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAETKEGVK
ITEKPSPPEKLGVTSTSKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKNWVKCAVAKST
HHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDMKNFPSHTVYVRA
GSNLKVDIPISGKPLPKVTLSRDGVPVKATMRFNTEITAENLTINLKESVTADAGRYEIT
AANSSGTAKAFINIVVLDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYILLKR
ETSTAVWTEVSATVARTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVKLPYTTP
GPPSTPWVTNVTRESITVGWHEPVSNGGSAVIGYHLEMKDRNSILWQKANKLVIRTTHFK
VTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAIDACEPPRNVRITDISKNSVSLSWQQ
PAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQFTISGLTQNSQYEFRVFARNAVGS
ISNPSEAVGPITCIDSYGGPVIDLPLEYTEVVKYRAGTSVRLRAGISGKPAPTIEWYKDD
KELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSASATIRVQILDKPGPPS
GPIEFKTVTAEKITILWRPPADDGGAKITHYIVEKRETSRVVWSMVSEHLEECIITTTKI
IKGNEYIFRVRAVNKYGIGEPLESDSVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPI
ADGGSDVSGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYRVCAVNAAGQGP
FSEPSEFYKAADPIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEMRQGEE
EEWTIVSTKGEVRTTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMTEPVQAKDILEAPE
IDLDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNIGSDARYSIENTDSSSLLT
IPQVTRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPPL
IDGGSPIINYVIEKRDATKRTWSVVSHKCSSTSFKLTELSEKTPFFFRVLAENEIGIGEP
CETTEPVKAAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTWS
HAGISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTIGPITVKELIITPEVDLSDIPG
AQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEH
GGKYTVILDNAVCRNAVPITVITLGPPSKPKGPIRFDEIKADTVILSWDVPEDDGGGEIT
CYSIEKRETSQTNWKMVCSSVARTTFKVPNLVKDAEYQFRVRAENRYGVSQPLVSNIIVA
KHQFRIPGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQKVNTSP
ISGREYRATGLVEGLDYQFRVYAENSAGLSSPSDPSKFTLAVSPVDPPGTPDYIDVTRET
ITLKWNPPLRDGGSKIVAYSIEKRQGNERWVRCNFTDVSECQYTVTGLSPGDRYEFRIIA
RNAVGTISPPSQSSGIIMTRDENVPPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRV
TWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGIYTVEAKNASGSAKAEIKVKVQD
TPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIEDKCEAQS
YTAIKLINGNEYQFRVSAVNKFGVGRPLDSDPVVAQIQYTVPDAPGTPEPSNVTGNSITL
TWARPESDGGSEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAE
NAAGVGPASGISRLIKCREPVNPPGPPAVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYII
EMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVD
RLTAPELDIDANFKQTHIVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLRADIHTTDSF
STLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGPPGPITFKDVTRGSATLMWD
APLLDGGARIHHYVVEKREASRRSWQVISEKCTRQILKVGDLAEGVPYYFRVSAVNEYGV
GEPYEMPEPIVATEQPAPPRRLDVVDTSKSSAVLAWLKPEHDGGSRITGYLLEMRQKGSD
FWVEAGHTKQLTFTVERLVENTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLT
GITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDS
MRGDSGRYFLTLENTAGVKTFTITVVVIGRPGPVTGPIEVSSVSAESCVLSWGEPKDDGG
TEITNYIVEKRESGTTAWHLVNSSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLESA
PIVAEHPFVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWVKE
NKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQNPVDAPGRPEVTDV
TRSTVSLIWSAPVYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGD
TYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLQGDLVTIRAGSDLVLDAA
VGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDTGKYTLTVKNASGTKA
VSVMVKVLDSPGPCGKLTVSRVTEEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVIV
EGECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVARNSFTIPSPPGIPEEVG
TGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCD
YQFRVTAVNAAGNSEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAWTKPMYDGG
ADITGYVLEMQEKDTDQWYRVHTKATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSE
SIAEIEPVERIEIPDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASR
AIIDTTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVS
RDSVTITWEIPTIDGGAPVNNYIVEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFR
VLPENIYGIGEPCETSDAVLVSEVPLVPTKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYV
LEACKAGTERWMKVVTLKPTVLEHTVTSLNEGEQYLFRVRAQNEKGVSEAREIVTAVTVQ
DLRVLPTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETH
TKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIRIDEIDATSIT
ISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRSTFKFTRLTEGNEYVFRVAATN
RFGIGSYLQSEVIECRSSIRIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVER
KEVRADRWVRVNKVPVTMTRYRSTGLIEGLEYEHRVTAINARGSGKPSRPSKPIVAMDPI
APPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTKIR
EYTLTHLPQGAEYRFRILACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGIFVRQ
GGVIRLTIPIKGKPFPICKWTKEGQDISKRAMIATSETHTELVIKEADRGDSGTYDLVLE
NKCGKKAVYIKVRVIGSPNSPEGPLEYDDIQARSVRVSWRPPADDGGADILGYILERREV
PKAAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVIPKTPLNPPE
PPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYT
VTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKDSVTLQ
WEKPECDGGKEILGYWVEYRQSGDSAWKKSSKERIKDKQFTIGGLLEATEYEFRVFAENE
TGLSRPRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFG
KELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHP
GYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKN
VQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPTDD
GGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISEPL
EVSSVVIIKSPFEKPGAPGKPTITAVTKDSCVVAWKPPVSDGGAKIRNYYLEKREKKQNK
WISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHF
KEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIA
SVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIP
FSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGID
QKTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLR
VGQARETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKEDKTRAMNYDEEVDE
TREVSMTKASHSSTKELYEKYMIAEDLGRGEFGIVHRCVETSSKKTYMAKFVKVKGTDQV
LVKKEISILNIARHRNILYLHESFESMEELVMIFEFISGLDIFERINTSAFELNEREIVS
YVHQVCEALQFLHSHNIGHFDIRPENIIYQTRRSSTIKIIEFGQARQLKPGDNFRLLFTA
PEYYAPEVHQHDVVSTATDMWSLGTLVYVLLSGINPFLAETNQQIIENIMNAEYTFDEEA
FKEISLEAMDFVDRLLVKERKSRMTASEALQHPWLKQKIERVSTKVIRTLKHRRYYHTLI
KKDLNMVVSAARISCGGAIRSQKGVSVAKVKVASIEIGPVSGQIMHAVGEEGGHVKYVCK
IENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKFDDGTYRCKVVNDYGED
SSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFG
VTITVHPEPRVTWYKSGQKIKPGDDDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNK
YGEDSCKAKLTVTLHPPPSDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEK
DGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERLRY
KKQEFKSREEHERHVQKQIDKTLRMAEILSGTESVPLTQVAKEALREASILYKPAVSTKT
VKGEFRLETEEKKEERKLRMPYDVPEPRKYKQTTIEEDQHIKQFVPMSDMKWYKKIRDQY
EMPGKLDRVVQKRPKRIRLSRWEQFYVMPLPRITDQYRPRWRIPKLSQDDLEIVRPARRR
TPSPDYYFYYRPRRRSLGDISDEELLLPIDDYLAMKRTEEERLRLEEELELGFSASPPSR
SPPRFELSSLRYSSPQAHVKVEETRKDFRYSTYHIPTKAEASTSYAELRERHAQAAYRQP
KQRQRIMAEKEDEELLRPVTTTQRLSEYKSELDYMSKEEKSRKKSRRQREVTEITEIEEE
YEISKRAQRESSSSASRLLRRRRSLSPTYIELMRPVSELIRSRPQPAEEYEDDTERRSPT
PERTRPRSPSPVSSERSLSRFERSARFDIFSRYESMKAALKTQKTSERKYEVLSQQPFTL
DHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNMSGVLT
LEILDCHIDDSGTYRAVCTNYKGEASDYATLDVTGGDYTTYASRRRDEEVPRSVFPELTR
TEAYAVSSFKKTSEMEASSSVREVKSQMTETRESLSSYEHHASAEMKSAALEEKSLEEKS
TTRKIKTTLAARMLTKPRSMTVHEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVT
TTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTVQKARVTEKAVTSPPRVKSPE
PRVKSPEAVKSPKRVKSPEPSHPKAVSPTETKTTSTEKVQHLPVSAPPKITQFLKAEASK
EIAKLTCVVESSVLSAKEVTWYKDGKKLKENGHFQFHYSADGTYELKIHNLTESDQGEYV
CEISGEGGTSKTNFQFVGQAFKSIHEKVSKISETKKSDQKTTESTETRKTEPKAPEPISS
KPVIVTGLHDTTVSSDSVAKFAVKATGEPRPTVIWTKDGKAITQGGKYKLSEDKGGFLLE
IHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAVKDTEAQKVSTQKTSEITSQKKAVVQE
EISQKALMSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEEITKTSQ
ASEEIRTHAEIKAFSTQMSINEGQRVVLKANIAGATDVKWVLNGIELTNSEEYRYGVSGS
DQTLTIKQASHRDEGILTCIGKTKEGIVKCQYDLMLSKELSDAPAFISQPRSQNINEGQN
VLFTCEISGEPSPEIEWFKNNLPISVSSNVSISRSRNIYSLEIRNASVSDSGKYTIKAKN
FRGQCSATASLTVLPLVEEPSREVVLRTSGDTSLQGSFSSQSVQMSASKQEASFSSFSSS
SASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGKSSMTQLESSTSKMLKAGIRGIPPK
IEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHNQEQQGRFHIENTDDLTTLI
IMDVQKQDGGLYTLSLGNEFGSDSATVNIHIRSI
NT seq 80925 nt NT seq  +upstreamnt  +downstreamnt
atgacaactcaagcaccgacgtttacgcagccgttacaaagcgttgtggtactggagggt
agtaccgcaacctttgaggctcacattagtggttttccagttcctgaggtgagctggatt
cgggatggccaggtgatttccacttccactctgcccggcgtgcagatctcctttagcgat
ggccgcgctaaactgacgatccccgccgtgactaaagccaacagtggacgatattccctg
agagccaccaatggatctggacaagcgactagtactgctgagcttctcgtgaaagctgag
acagcaccacccaacttcgttcaacgactgcagagcatgaccgtgagacaaggaagccaa
gtgagactccaagtgagagtgactggaatccctacacctgtggtgaagttctaccgggat
ggagccgaaatccagagctcccttgatttccaaatttcacaagaaggcgagctctacagc
ttactgattgcagaagcataccctgaagactcagggacctattcagtaaatgccaccaat
agcgttggaagagctacttcgactgctgaattactggttcaaggtgaagaagaagtacct
gctaaaaagacaaagacaattgtttcgactgctcagatttcagaatcaagacaaacccga
attgaaaagaagattgaagcccactttgatgccagatcaattgcaaccgttgagatggtc
atagatggtgccgctgggcaacagctgccacataaaacacctcccaggattcctccgaag
ccaaaatcaagatccccaacgccaccgtccattgctgccaaagcacagctggctcggcag
cagtccccatcgcccataagacactccccttccccggtcagacacgtgcgggcaccgacc
ccatcgccggtcaggtccgtgtctccggcagcaagaatctccacatcccccatcaggtct
gttaggtctccattgctcacgcgtaagactcaggcatccaccatggccacaggtcccgaa
gtgccacccccttggaagcaagagggatacgtggcctcctcatctgaggctgagatgaga
gagacaaggctgacaacctctactcagatcaggacagaagagagatgggaagggagatac
ggtatccaggagcaaatgaccatcagtggcgctgcgggtgctgccgccagtgtgtcggcc
agtgctacctacgcagcagaggctgttgccactggtgctaaagaggtgaaacaagatgct
gacaaaagtgcagctgttgcgactgttgttgctgccgttgatatggccagagtgagagaa
ccagtgatcagcgctgtagagcagactgctcagaggacaaccacgactgctgtgcacgtc
caacctgctcaagaacagcaggtgagaaaggaggcggagaagactgctgtaactaaggta
gtagtggccgccgacaaagccaaggaacaagaattaaaatcaagaaccagagaagtaatt
accacaaagcaagagcagatgcacgtaactcatgagcagataagaaaagaaactgaaaaa
acatttgtaccaaaggtagtaatttcggcagctaaagccaaagaacaagaaactagaatt
tctggagaaattactacgaaacaaaaacaagtaactcaagaaacaataagacaggaaact
gagataactgctgcatccatggtggtagttgccactgcaaagtccacaaaactagaaaca
gtcccgggagctcaagaagaaactgccacacaacaagatcaaatgcacctaagtcatgaa
aagataatgaaggaaactaggaaaacagttgtacctaaagtcatagttgccacacccaaa
gtcaaagaacaagatttagtatcaagaagtagagaaggcattactaccaaaagagaacaa
gttcaaataactcaggaaaagatgagaaaggaagctgagaaaactgccttgtctacaata
gcagttgctactgctaaagccaaagaacaagaaacaatactgagaactagagaaactatg
gctactagacaagaacaaacccaagttacccatggaaaggtggatgttggaaaaaaggct
gaagctgtagcaacagttgttgctgcagtagaccaagcccgagtcagagagcccagagag
cctgggcgtcttgaagaatcctatgctcagcagaccactttggagtacggatataaggaa
cgcatttccgccgcaaaggtagctgagcctccccaacgtccagcctcagaaccccacgtt
gtccctaaagcagtcaagcctgtagtaatccaggctccttctgagactcatatcaaaact
actgatcaaatgggaatgcacatatcatcacagatcaagaaaactacagatctaacaacg
gaaagattagtccatgtagataaacgcccccgcacagcgagccctcactttactgtttca
aaaatttctgttcctaagacagaacatggatatgaggcatcaatagccggtagtgctatt
gccacattacaaaaagagttgtcagccacatcttctgctcagaagatcaccaaatcggtg
aaggctcctactgtgaagcccagtgagactagagtaagggcagagcccacaccctcgcca
cagttccccttcgctgacacgccagatacttacaagagtcaagctggcgttgaggtgaaa
aaggaagtaggggtgagcatcactggcgccaccgtccgtgaagagcgctttgaagtactg
cacgggcgcgaagccaaggtcacagaaacagcaagagtaccagcacctgttgaaattcct
gttactccaccaactttggtctcgggcttaaaaaatgtgacagtcatagaaggtgaatct
gtcaccttggagtgccacatctctggatacccatccccgacagtgacatggtacagggaa
gactaccaaatcgaaagttccattgacttccagataaccttccagagtggaattgctcgt
cttatgattcgcgaagcgtttgcggaagacagcgggcgatttacctgcagtgctgttaac
gaggctggaaccgtcagcacatcctgctatctggctgtgcaggtgtcagaagaatttgaa
aaggaaaccacagccgtgactgagaaatttaccacagaagagaaacgctttgttgagtca
agagatgtggttatgactgatactagcatcacagaggaacaagcagggcctggagaacct
gctgcgccttactttattacaaaaccagtggtccagaaactggtggaaggtgggagcgtg
gtgtttggatgccaagttggtggcaacccaaagccccatgtgtactggaaaaaatctggt
gttcctctgaccactggatacagatacaaagtgagttacaacaaacaaaccggtgaatgc
aagctagtaatttctatgacttttgctgatgatgctggagaatacactattgttattcgt
aataagcatggagaaacttctgcatctgcttccttgcttgaagaagctgattatgagtca
ctgatgaagtcccagcaagaaatgctttaccagacacaagtgactgcatttgttcaagaa
cccaaagttggagaaacagcccctggatttgtatattctgagtatgaaaaagagtatgaa
aaagaacaagccttaattaggaagaaaatggccaaagatactgtaatggtcagaacatat
gtagaagatcaggaattccatatttcttcctttgaagagagacttattaaagaaattgaa
tatagaataataaagactacattagaagaacttcttgaagaagatggagaagaaaagatg
gcagttgacatttctgaatctgaagctgttgaatcaggatttgagttaagaatcaagaat
tatagaattcttgaggggatgggtgtcacttttcattgcaagatgtctggatatccatta
ccaaagattgcttggtacaaagatggcaagcgcatcaaacatggagaaagatatcaaatg
gactttctacaagatggcagagctagtctgcgtatacctgttgttcttccagaagatgaa
ggaatctacactgcatttgccagcaatattaaaggaaatgcaatttgctcagggaaattg
tatgtggagcctgctgcaccacttggagctccaacttacatccccacaccagagccagtg
agcagaatcagatctctctctccacgttcagtgagcaggtctcctatacgcatgtctcct
gcacggatgtcacctgcaaggatgtctcctgcacggatgtcccctgcaagaatgtcccct
ggacgtaggctggaggagacagatgagtcacaacttgagagactgtataaaccagtcttt
gtgttaaaacctgcttctttcaaatgtttagaagggcaaactgccagatttgacttaaag
gttgttggtagacctatgccagagacgttctggtttcatgatggccagcaaattgtcaat
gactatacccataaagtggtcattaaagaagatggtactcaatcactaattattgtccct
gccacacccagtgattctggggaatggactgtggttgcccaaaacagggcaggcagatct
tcaatttcagtgattttaactgtggaagctgtggaacatcaggtaaaaccgatgtttgta
gaaaaactgaaaaatctcaatgtaaaggaaggttcccgacttgaaatgaaagtcagagct
acgggtaaccccaaccctgacattgtatggttgaaaaacagtgacatcattgtgcctcat
aaatatcccaaaatcagaattgaaggaaccaagggagaagctgcccttaaaatcgattcc
actgtcagccaagattctgcctggtataccgcgactgctattaataaagctggcagagac
actacaagatgcaaagtaaatgttgaagttgagtttgcagagcctgaaccagagagaaaa
ttaatcatcccaagggggacatatagagcaaaggagattgcagccccagaactggagccc
ctccatttgcgatatggtcaagagcaatgggaagaaggtgatctctatgacaaagagaaa
caacagaaaccattcttcaagaaaaaactcacctccttaagacttaagcgctttggacct
gcccactttgaatgcaggctaacacccattggtgacccaacgatggtggtggagtggctc
catgatggaaagccacttgaggcagccaacaggctccgtatgataaatgaatttgggtac
tgcagccttgattatggtgttgcatattctagagacagtggtatcattacttgcagagcc
actaacaaatacggaacagatcatacatctgctacccttattgttaaagatgagaaaagt
cttgtggaagaatcccagttgcctgaggggaggaaaggcttacagagaattgaagaatta
gagagaatggctcatgaaggtgcacttacaggtgtaacaacagatcagaaagaaaagcaa
aagccagacattgtcttgttcccagagccagttagagtacttgaaggggagactgcaagg
ttccgctgcagggtaacaggctaccctcagcccaaagtcaactggtacctcaatggacag
ctcattcgcaaaagcaaaaggttcagagttcgctatgatggtatccattacctggacatc
gtggactgcaaatcatatgacacaggtgaagtgaaggtcaccgcagaaaatcctgaaggt
gtgatagagcataaagtgaagcttgagattcaacagagggaagattttaggtctgttctt
aggagagctcctgaaccaaggcccgagtttcatgtacacgaaccaggaaagcttcagttt
gaagtacaaaaagtggatagacctgttgacaccactgaaaccaaagaagttgtgaagttg
aaaagggctgaaagaattacccatgaaaaagtgcccgaagagtcggaagagctgcgcagt
aaattcaagcgcagaacagaagagggctattatgaagccattaccgctgtggagctcaag
tctcgaaagaaagatgaatcctatgaggaactcctcaggaagacaaaagatgaacttctc
cactggaccaaagagttaactgaagaggaaaagaaagctcttgccgaagaaggcaaaatc
acgattccaacttttaaacctgataagattgaactaagtcctagtatggaggctccaaaa
atcttcgaaagaatccaaagccaaacagtgggccaaggatctgatgcacacttccgggtc
agagtcgtggggaaaccagaccctgaatgtgaatggtacaaaaatggtgtcaaaattgaa
cggtctgaccggatctactggtactggcccgaagacaatgtttgtgaattggtcataaga
gatgtgactgctgaggactctgccagcatcatggtaaaagccatcaacatagctggagaa
acctccagtcacgcattcttacttgtccaagccaagcaattgatcactttcacacaggaa
ttacaagatgttgttgctaaggaaaaagatactatggcaacatttgaatgtgaaacttca
gaaccatttgtcaaagtgaaatggtataaagatggtatggaggttcatgagggagataaa
tacaggatgcactctgacagaaaggttcacttcctctccatactgaccattgatatgtct
gatgctgaagattacagctgtgtacttgtggaagatgaaaatatcaaaacaactgctaaa
cttattgttgaaggtgcagttgttgagtttgtgaaggaacttgaggacatagaagttcca
gaatcatattcaggagaattagagtgtattgtatccccagaaaatatagaaggaaaatgg
tatcataacaatgtggagcttaaatccaatggcaaatacacaattacatctcgtcgtgga
cgtcagaacctcacagtcaaggacgtaaccaaggaggaccagggagaatacagctttgtc
attgacggaaaaaagacaacctgtaaactaaagatgaaaccccgccccattgctatccta
caaggacttagtgaccaaaaagtctgtgagggtgacattgttcagcttgaagttaaagtc
tccttggaaagtgtggaaggtgtctggatgaaagacggccaagaagtgcagcccagtgac
aggattcacattgtgatagacaaacaatctcatatgctgctcattgaagacatgactaag
gaagatgctggaaattactctttcaccattccagcccttggcctctccaccagtgggcgt
gtctctgtctatagtgtggacgtgataacacctctaaaagatgttaacgtgattgaaggc
acaaaggctgtgcttgaatgtaaggtctcagtccctgatgtgacttctgttaagtggtac
ttaaatgatgaacaaatcaagcctgatgaccgtgtacatgccattgtaaaaggtactaaa
cagcggctagtcattaaccgaactcatgcttcagacgaaggaccctacaagctgatagtt
ggcagagttgaaaccaactgtaatctctctgtagaaaaaattaaaattatcagaggtctt
cgtgaccttacctgtacagaaactcaaaatgtggtgtttgaggttgagctgtcccactct
ggaattgatgtcttgtggaattttaaggacaaggaaatcaaacccagttctaaatataaa
atcgaagcacacggaaaaatatataaactgacagttctaaatatgatgaaagatgatgaa
ggaaaatatacattttatgcgggagaaaatatgacatctggaaaacttactgtggcaggt
ggggccatctccaagccactcacagatcagaccgtagctgaatcccaggaagctgtgttt
gaatgtgaagttgccaacccagattccaaaggtgaatggttgagggatggcaaacaccta
ccactgactaacaacatcagaagtgagtctgatggccacaaaaggagacttatcattgct
gccaccaaattagatgacattggagaatatacctacaaggtggccacctccaaaacatct
gccaaacttaaagttgaagctgtcaaaattaagaagactctgaagaacctcacagtgaca
gaaacacaggatgctgttttcactgtcgagcttacacaccctaatgtcaaaggtgtccag
tggatcaaaaatggagttgtgctggaatccaatgaaaagtatgctatctctgtcaaagga
acagtttactctctgaggattaaaaactgtgccatcgtggatgagtctgtttatggcttc
aggcttggaaggctaggagccagtgccaggctgcacgttgagactgtcaagatcattaaa
aagccaaaggatgtgacagccttggaaaatgccactgttgcctttgaagttagtgtttcc
catgacaccgttccagtaaaatggttccataagaatgtggaaattaagccaagtgacaaa
cacagactggtctcagaaaggaaggtccacaagctgatgctgcagaacatctccccctca
gatgctggggaatacacagctgtggtggggcaactggaatgcaaagcaaaactgtttgtg
gagacattacatattacaaaaaccatgaaaaatatcgaggtgcctgagaccaaaactgcc
tcttttgagtgtgaggtgtcccacttcaatgtcccttccatgtggctgaagaatggtgtg
gaaattgagatgagtgaaaagttcaagatagttgtgcagggaaaactccaccagctgatc
atcatgaacaccagcacggaggactcggcagaatacacatttgtctgtggcaatgaccaa
gtcagcgccaccctgacagtcaccccaatcatgattacttccatgctgaaagacatcaac
gctgaagaaaaagacactattacttttgaggtgacagtgaactatgaaggcatctcttac
aaatggttaaagaatggtgtggaaatcaaatcaactgacaagtgccagatgagaaccaaa
aagctcacacactccctgaacatcaggaatgttcactttggggatgctgctgactacacc
tttgtggctggaaaagctacatcaacagccacactttatgtggaagctcgtcatatagaa
tttaggaaacacattaaggacattaaggttctggagaagaagcgagccatgtttgaatgt
gaagtttctgaacctgatatcactgtacagtggatgaaagatgaccaggaactgcagatc
acagacagaataaagattcagaaggagaaatatgtccaccgccttctgatcccatccacc
cggatgtctgatgctgggaagtacacagtggtggcaggaggcaacgtgtcaactgcaaac
ctctttgtagaaggcagagatgttcgcatccgaagtattaaaaaggaggttcaggtcatt
gagaaacagcgtgctgttgttgagtttgaggtcaatgaagacgatgttgatgcccactgg
tataaagacggcattgaaatcaatttccaagttcaagaacgacacaaatatgtggtggag
agaagaatccaccgaatgtttatctctgagaccagacagagtgatgcaggagaatacacc
tttgtggcaggaaggaacaggagttctgtcactctctatgtcaatgctcctgaaccgccc
caagttctgcaggagctccagcctgtcactgtgcagtctggcaagccggcccgcttctgt
gccgtgatatccggcagaccacagcccaaaatttcctggtacaaggaagagcagctgctt
tccactggcttcaagtgcaaatttcttcatgatgggcaagagtacacgcttttgctaatt
gaagccttcccagaggatgcggcagtctatacctgtgaagccaagaatgactatggagtt
gccacaacatcagcttcactctcagtggaagttccagaaattgtgtctcccgatcaggaa
atgccagtttatccacctgccatcatcaccccgcttcaggacactgtcacttcggaaggg
cagccagcccgttttcaatgccgggtttctggaacagatctaaaagtgtcttggtacagc
aaagacaagaaaatcaagccatctcggttctttagaatgactcaatttgaagacacttac
caactggaaattgccgaagcttatccagaagatgaaggaacttacacgtttgttgctagt
aatgctgtaggccaagtgtcaagcacagccaacctaagtctggaagcccctgaatcaatt
ttgcatgagaggattgaacaagagattgagatggaaatgaaagagtttgctagttctttt
ctgtctgccgaggaagaagaacttcatagctctgaacttcatttatctaatataaatgaa
acacttgaacttttgtctgaacctccagtttactcaactaaatttgattccaaaaaggaa
ggcgctgtcccagttttcatcaaagaagtgtcaagtgctgatacaagcatgggggatgtg
gctacactgtctgtaactgtcattggcatccccaaacctaaaattcagtggttctttaat
ggagtgccattaaccccttctgctgactacaaatttgtttttgacggtgatgatcatagc
ctgatcattctgttcaccacattggaggatgagggagagtatacatgtatggctagtaat
gactatggacaagcaatatgtagtgcctatctaaaaataaattccaaaggagaaggtcac
aaagacacagaaacagaatcagcagtggcaaaatctctggaaaagcttggaggtccttgt
cctcctcacttccttaaggagttaaaagcagttcgctgtgctcaaggacttcctgccatc
tttgagtacacagtagttggagagcctgcccctactgttgcatggttcaaagaaaacaag
cagctatgcaccagtgtttattacactatcattcataaccctgatggctctgggactttc
attgtcaatgaccctcagagggaagacagtggcctctatatctgtaaagcagagaatatg
ctgggtgagtccacctgtgcagcagaacttcttgtgcttctggaagacacagacatgact
gataccccctgcaaagcaaagtccacaccggaggctcctgaggatttttcacagacaccc
ttaaagggtcccgcagttgaagcagttgactcagagcaggaaattgcaacgtttgtaaaa
gacaccattctgcaagcttctttaattacagaagaaaaccagcaactatcttatgagcat
attgctaaagccaatgaattgagcagccagcttcctttgggagctcaggaattacaatcc
attttgaagcaagacaagtccactcctgaaagcaccagggaatttctttgcatcaatggc
agtactcactttcagcctctcaaggaaccctctcccaacctacaactgcagactgtacag
tcccagaaaaccttctccaaagaaagcattctaatgcttgaagagcctgagacacaggcg
gttctatcagagactgagaaaatcttcccaagtgccatgttcatagaacaaattaattca
ttaacagttgagcctctgaaaactgtattaactgaacctgaagggaattatccacagtct
tcaatagaacctccggtgcattcttatctaacctctgtggctgaggaagtgcttttacca
aaagaaaagacagtgtctgatgccaacaaagaccaaagagtgactcttcaaaagcaagag
gcacaaagtgcactcatcttgagtcagagcttagcagagggacacgtggagagtctccag
agtcctgatgtcatgatctctcaggtaaactatgagcccctagtcccttcagaacactca
tgcacagaaggagctgaaattttgatagaaagtgcagatccactggaaaatgcagggcaa
gattctgcggtcagaattgaggaaggcaagtccttaagatttccgctagcacttgaagaa
aagcaggtactgctcaaagaagagcattctgacaacgtggtgatgcccccagaccaaatc
attgagtctaaaagagagcctgtggcgataaagaaagtgcaggaggtacagggaagggac
attctttctaaggaaagcttgctttctggtattccagaagaacagcgattaaatctgaaa
attcaaatccgcagggctttgcaagcagctgtggccagtgagcagccaggtcttttctct
gagtggctaagaaatattgaaaaggtggaggtcatggccgtaaacatcacccaagagccc
agacacatcatgtgcacgtaccttgttacttcggcgaagtctataacagaagaagtaacc
atcattattgaagatgttgatcctcaaatcactaacctgaaaatggaacttaaggatgtt
ttgtgtgctattatatatgaggaaataagcatcctaacagctgagggtcctagaattcag
caaggagccaaaacaagtttgcaggaagaaatggattctttttcaggttcacagaaggtt
gaacccattactgaaccagaagttgaatctaaatatcttatctcaactgaagaggtcagg
tattttaacatgcaaagtcaggttaaatatttggatgccacaactgtcactaatggggtt
gcttcagctgttgtctctgatgagaaacaagatgagagtctgaaaccatcagaggaaaaa
gaggagtcctcctctgaaagtggtactgaggaggttggtacagtaaagatacaggaacct
gagggtggcttaatcaaagaggatggccccgtgatacatacacccttaatggacactgtt
tctgaggaaggtgacattgtacacctcacaacatccataacaaatgctaaagaggtgaat
tggtattttgagaataaactggtgccttcagatgaaaagttcaagtgtttacaagatcaa
aatacgtatacgctagtcatcgacaaagtaaataccgaagatcatcaaggagagtatgtc
tgtgaggccttgaatgacaacggaaaaacagcaacttcagccaaactcactgtagtaaaa
agagctgccccagtgatcaggaggagaatcgaacccctggaagtagcactgggccaccta
gccaaattcacctgtgagatccaaagtgctcccaatgtccggttccagtggtttaaagct
ggccgagaaatttatgagagtgacaagtgttctattcgatcttcaaaatatgtctccagc
cttgaaatcctaagaacccaggtggttgactgcggcgagtatacatgcaaagcttccaat
gagtatggcagtgtcagctgtacagccacactaactgtgacagtgcctggaggtgaaaag
aaagttcgcaaattacttcctgaacgtaaacctgaaccaaaggaagaagttgttctgaaa
agcgttctaagaaaaagacctgaagaagaagagcctaaagtagaacctaaaaaactagaa
aaagttaaaaaacctgcagtaccagaaccaccacctccaaaacctgttgaagaggttgaa
gtacctactgttacaaaaagagaaaggaagattcctgaaccaacaaaagtgcctgaaatc
aagccagcaatacctctccctggacctgaaccgaaaccaaagcctgaagcagaagtgaaa
acaatcaaaccacctcctgtggaacctgaaccaacccccatcgctgccccagtaacagtg
ccggtggttggaaagaaagcagaagccaaagcacctaaggaagaggctgccaagccaaaa
ggtcctatcaaaggtgtagccaaaaagactccttcaccaatagaagccgaaaggaggaaa
ttaaggccaggaagtggtggagagaaacctcctgatgaagccccattcacctaccagcta
aaggctgtgccattgaagtttgtgaaagaaatcaaagacatcgtcttgactgaatcagag
ttcgttggctcttcagcaatctttgaatgtttggtctccccctccactgcaattacaacc
tggatgaaagatggtagcaatatccgtgagagccccaagcacaggtttattgcagatggt
aaagacagaaagctgcacatcattgacgttcaactttccgatgctggtgaatacacctgt
gttttacgtttgggaaacaaagaaaagacctccacggctaaacttgttgtagaagaactt
cctgtgcgttttgtaaaaacactggaagaggaagtcacagtggtcaaaggacagccattg
tacttgagctgcgagttaaacaaagagcgtgatgttgtctggaggaaggatggcaagatt
gtggtggagaaacctggccgaattgtgccgggcgtcattggcttgatgcgggccctgacc
atcaacgatgcagatgacacagatgctggaacatacacagttactgtggaaaacgccaac
aacctggagtgttcatcttgcgtaaaagtagtagaagtcattagagattggctggtgaaa
cctatacgagaccagcatgtgaaacccaaggggacagctatttttgcctgtgatatagca
aaagatactccaaacattaagtggttcaaaggatatgatgaaatccctgcagaaccaaat
gataagactgaaatactgagagatggaaatcatctatacctcaaaattaagaatgctatg
ccagaagatattgacgaatatgcagtggaaattgaaggaaaaagataccctgcaaagctg
acacttggagagcgtgaagttgaactgcttaaaccaatagaggacgttaccatctatgag
aaagaaagtgcaagctttgatgcagaaatctcagaggcagacattcctggacaatggaaa
ctgaaaggagaacttctaaggccctcacctacttgtgaaatcaaagcagaaggtggaaaa
cgcttcttaactttgcacaaagtcaaactggaccaagctggtgaagtcctctaccaggcc
ctgaatgcaattacaactgccattttgacagtaaaagaaatcgaacttgactttgctgtg
cccctgaaggatgtcactgttccagaaaggcgacaggctcgattcgaatgtgtcctcacc
cgagaggcaaatgttatatggtccaaaggacccgatataatcaagtcatctgacaaattc
gatatcattgctgatggaaagaaacatattctcgttattaatgattctcaatttgatgat
gaaggggtctatactgctgaggtagagggcaagaagacctcagctcggttatttgtcaca
ggtataagactgaaattcatgtcgcctcttgaagatcagacagtaaaagaaggtgaaaca
gcaacttttgtatgtgaactttctcatgaaaaaatgcatgtagtctggttcaaaaatgat
gtcaaactccacacaagcagaacagtactcatctcttctgagggcaagactcacaaattg
gaaatgaaagaagtgacactggatgatatatctcagataaaagctcaagtcaaggatctg
agctccacagcacagctgaaggtcttagaggctgatccctacttcactgtgaaattacat
gacaaaactgcagtggagaaggatgagattattttgaagtgtgaattgagcaaggatgta
ccagtgaaatggttcaaagatggtgaagagattgtcccttcacccaaatattctatcaag
gcagatggcctgcgccgcattttaaaaatcaaaaaggcagaacttaaagataaaggcgaa
tatgtgtgtgactgtggcacagacaagaccaaggcaaatgttactgttgaggctcgacta
ataaaagtggaaaagcctctgtatggagtagaggtgtttgttggtgaaacagcccgcttt
gaaattgaactttctgaacctgatgttcacggccagtggaagctgaaaggagagcctttg
acagcttcccctgactgtgaaatcattgaggatgggaagaagcatattctgatccttcat
aactgtcagctgggtatgacaggagaggtttccttccaggctgctaatgccaaatctgca
gctaatctgaaagtgaaagaattgcctcttatcttcatcacacctctcagtgatgttaaa
gtcttcgagaaagatgaggctaagtttgagtgtgaagtatccagggaacccaaaacattc
cgttggctaaaaggaacccaggaaatcacaggtgatgacagaattgagcttataaaggat
ggcactaagcattcaatggtgatcaagtcggctgcttttgaagatgaagcaaaatacatg
tttgaagctgaagataagcacacaagtggcaaactgatcattgaaggaatccggcttaaa
tttctcactcctctcaaggatgtaactgccaaagagaaggaaagtgctgtgtttactgtg
gagttatctcatgataacatccgagttaaatggttcaagaatgaccagcgcctacacacc
accaggtcggtctcaatgcaagacgaagggaaaactcattcaatcacattcaaagacctg
tctattgatgatacctctcaaattagagtagaagctatggggatgagttcagaagctaaa
ctcactgtgcttgagggagacccgtattttacaggaaaacttcaagattatactggtgta
gagaaagatgaagttattctacagtgtgaaattagcaaagcagatgcaccagtgaaatgg
tttaaggatgggaaggaaataaagccatccaaaaatgctgttattaaggcagatggcaag
aaacgcatgctaatcctaaagaaagccttgaaatcggatattggacagtacacctgtgac
tgtgggacagataagacctcaggaaaacttgacattgaggatcgggaaattaaactggtg
cgacccctgcacagtgtggaggtgatggagactgagacggcccgctttgaaaccgaaatc
tctgaagatgatatccacgccaactggaaactcaagggagaggccctactccaaacacct
gattgtgaaattaaggaagaaggcaaaatacactcccttgttttgcacaactgtcgcctg
gaccagactggtggggtggatttccaagctgccaatgttaaatctagtgctcacctccga
gttaagccacgagtaattggtcttctgaggcctttaaaggatgtcaccgtgactgcaggg
gaaacagccaccttcgactgcgagctctcctacgaggatatccccgtagaatggtatctc
aaagggaagaaactagagcccagcgataaggtggtcacacgttcagaaggaaaagttcat
acacttactctgagggatgtaaagttagaagatgctggggaagtccaactaacagcaaaa
gatttcaaaactcacgccaacctctttgtgaaagaacccccagttgaattcactaagcct
cttgaggaccagacggtcgaagagggagccactgcagtgctggagtgtgaagtctccaga
gaaaatgctaaggtgaaatggttcaaaaatgggacagaaatcctcaaaagcaagaagtat
gaaattgttgctgatggcagggtcagaaaacttattatacacggctgtaccccagaggat
attaaaacatacacttgtgatgctaaggattttaagacttcctgtaacctgaatgtcgtg
cctcctcatgtggaattcttaagaccactcacagaccttcaagttagagaaaaagaaatg
gctcgatttgagtgtgaactttcccgagaaaatgctaaggttcagtggtttaaagatggt
gctgaaattaaaaagggcaaaaaatatgacatcatatccaagggagcggtgcgcattctt
gtcatcaacaaatgtctactggatgacgaagctgaatattcctgtgaagtaaggacagcg
agaacttctggcatgctgacagttctggaagaagaagctgtctttaccaaaaatcttgcc
aacattgaagttagtgaaacagacactataaaattggtttgtgaagtctccaaacctggt
gcagaagtgatttggtataaaggggatgaggagatcattgaaacaggaagatatgaaata
ctgactgaaggacggaagagaatcctggtcattcagaacgctcaccttgaggatgccggc
aactacaactgtcgactcccaagctctcgaaccgatggcaaagtcaaagtacatgaactg
gctgctgaatttatctcaaagcctcaaaaccttgaaatacttgaaggagaaaaggctgaa
tttgtctgctctatatcaaaagaaagctttccagtccagtggaagagggatgataagata
cttgaatctggagataaatatgacgttattgctgatggtaaaaagagagttctagttgtg
aaagatgccacattacaagatatgggcacttacgtcgtcatggtaggggccgccagagca
gcagctcacttgacagtcattgaaaaactcaggatcgtagttcctcttaaggacacccgg
gtgaaggaacaacaagaagttgtcttcaactgtgaagtcaacactgaaggtgccaaagcc
aaatggttcagaaatgaagaagccatatttgatagttcaaaatacattattctccaaaaa
gacctggtctacaccctcagaattagagatgcacgcttagacgaccaagccaactataat
gtgtctttgaccaatcacagaggtgaaaatgttaaaagtgcagccaatctaatagtagaa
gaggaagaccttaggattgttgagcctcttaaagatattgaaacaatggagaagaaatct
gtcacattctggtgcaaggtgaatcgtctcaatgtaacactgaagtggaccaaaaatggt
gaagaagtgccttttgacaaccgtgtctcatacagaattgataaatacaagcactcgtta
actattaaagactgtggcttcccagatgaaggtgaatacattgtcactgctggacaagac
aaatctgttgctgagcttctcatcatagaagcccctacagaatttgtggaacacttggaa
gatcagacagtcactgagtttgatgacgctgtcttctcctgccagctctccagagagaaa
gccaatgtaaaatggtacagaaatgggagagaaatcaaagaaggcaaaaaatacaaattt
gaaaaagatggaagtatacacagactcattataaaagattgcaggctggatgatgagtgt
gaatatgcttgtggagtagaagacaggaagtctcgtgctagactttttgtggaagaaatt
cccgttgagatcatcaggcctccacaagatattcttgaagcccctggtgctgatgttgtc
tttttagcagaactcaataaagataaggtggaagtccaatggctaagaaataacatggtt
gttgtccagggtgataaacaccagatgatgagtgaaggaaagatacatcgactacagatt
tgtgatattaagccccgtgaccagggtgaatacagatttattgccaaagataaagaagcc
agagctaagcttgaactggcagctgcaccgaaaatcaagacaggtgaccaagaccttgtg
gttgatgttggccagcctctgacaatggtggtgccatatgatgcctaccccaaagcagaa
gctgaatggtttaaagaaaatgaacctttatctacaaaaaccattgatactacggctgaa
caaacttctttcagaattttagaagccaagaaaggagacaaagggagatataaaattgtg
cttcagaacaaacatggaaaagcagaaggattcatcaatctaaaagttattgatgttcct
gggccagtacgtaacttagaagtgacagaaacatttgatggtgaagtgagccttgcttgg
gaagaacctttaactgatggtggaagcaaaatcataggttatgttgttgaaagacgtgac
attaagagaaagacctgggttctggccacagaccgtgcagacagttgtgagtttactgtc
actggtctacagaaaggaggagttgagtatctattccgtgtaagtgcaagaaacagagtt
ggcactggtgaaccagtagaaactgacattcctgtagaagcaaggagtaaatatgatgtt
ccaggccctcctttgaatgtaaccatcactgatgtgaatcgatttggtgtctcactgaca
tgggaaccaccagagtatgatggaggtgctgagatcacaaactacgtcattgaattaaga
gacaagacatctatcaggtgggatactgccatgactgtgagagctgaagacctgtctgca
actgttactgatgtggtagaaggacaggagtacagtttccgagtgagagcccaaaatcga
attggagtcggaaaaccaagtgcagccacacccttcgtcaaagttgccgatccaattgag
agaccaagtcctcctgtaaacctaacttcctcagatcagactcagtcatcagttcaactc
aaatgggaacctcctctgaaagatggaggaagcccagtattaggctatataattgagcga
tgtgaagaaggaaaagataattggattcgttgcaataagaaacttgtccctgaactgact
tacaaggttaccggattggaaaaaggaaataaatatttatatagagtatctgcagaaaat
aaagctggtgtttcagatccatcagaaattcttggtcctctcaccgctgatgatgcattt
gttgaaccaacaatggatttaagtgcatttaaagatggtctggaagttattgtcccaaat
cctatcaagatcctggttccaagtacaggctatccaaggccaactgcaacctggtgtttt
ggagataaagtactagaaacaggggaccgtgtgaaaatgaagaccttgtctgcctatgcc
gaacttgtcatttctccaagtgaacgttcagacaagggcatttatacgctgaaattagaa
aaccgtgtgaaaacaatttctggggaaatcgatgtcaatgtaatcgctcgcccaagtgca
cccaaagaactgaaatttggtgatataaccaaggactcagtacatttgacttgggaacca
cctgatgatgatggaggaagtccattaaccggatacgttgttgaaaaacgagaagtcagc
cggaaaacatggactaaggttatggactttgtaactgatctagaattcacagttcctgat
cttgttcaaggaaaagagtatttatttaaagtttgtgctcgtaacaaatgtggccctgga
gaacctgcatatgttgatgaacctgtaaatatgtcagctcctgcaacggtacctgaccca
ccagagaatgttaaatggagagatcgaacagccaatagcatcttcttaacatgggatcca
cctaaaaatgacggtggttcacgcatcaaaggatatatagttgaaagatgtccacgtggt
tctgataaatgggttgcctgtggagaacctgttgcagaaacaaagatggaagtgacaggt
cttgaggaaggcaaatggtatgcctaccgcgtgaaggccttaaacaggcagggtgctagc
aaaccaagcaaacccacagaggagatccaggctgtggacacacaagaggccccagaaatc
ttcctcgatgtgaagctccttgctggtctcaccgtaaaagctgggaccaagattgaactt
cctgccactgtaaccgggaaacctgaacctaaaataacttggacaaaggctgatacgatt
ctgaagcaggacaaaagaattaccattgaaaatgtccctaagaaatccacagtgactatt
gttgatagtaagagaagtgacactggcacatacatcatcgaggctgtgaatgtgtgtggc
cgggccactgctgtggtggaagtgaacgtcttagataaacctggaccaccagctgccttt
gacatcacagatgtaaccaatgagtcatgtcttctaacatggaacccaccacgcgatgat
ggtggatctaagatcacaaactatgttgtggagagacgagcaactgatagtgaagtgtgg
cacaagctctcatccaccgtcaaggatacaaacttcaaggccaccaaattaatccccaat
aaagagtacatcttcagagttgctgcagaaaacatgtatggtgttggtgaaccagttcag
gcctctccaataacagccaaatatcagtttgatccacctggacctccaactcgcctagaa
ccttctgatatcactaaagatgcagtgactctcacgtggtgtgagccagatgatgatggt
ggcagcccaatcactggatactgggttgaaagactggatcctgatacggataaatgggtt
agatgcaataagatgccagtaaaggacacaacatacagagtgaaaggtctcaccaataag
aaaaaatacagattccgtgtgttggctgaaaatcttgctggacctggaaaaccaagcaaa
tcaactgaaccaatcttaataaaggatcccatagatcctccatggccccctggaaaacca
actgtaaaagatgtaggcaaaacatcattaaggttgaattggacaaaaccagaacacgat
ggaggcgcaaagattgagtcttatatcattgaaatgctgaagactgggacagatgagtgg
gtcagagtggcggaaggggttcccaccactcagcacttgctcccagggctcatggaagga
caggaatactcattccgagttagagctgtgaataaggctggggaaagtgaacccagtgaa
cccagcgaccctgtgctttgccgggagaagctatatcctccgtcaccaccacgctggctt
gaagttattaatatcacaaaaaatacagcagacctaaaatggacagttcctgagaaagat
ggagggtcccccatcaccaactacattgtagaaaagagagacgtcaggcgaaaaggctgg
caaacagtggataccactgtcaaggacaccaagtgcacagtcaccccgctgactgagggc
tctttatatgtgttccgagttgctgcagaaaatgctataggacaaagtgactacaccgaa
attgaggactctgtgctggccaaagacacctttaccactcctggaccaccctatgccctg
gcagtggttgatgtgacaaaacgacatgttgacctaaagtgggagccacctaaaaatgat
ggtggaagaccaattcagagatatatcattgagaagaaagaaaggttaggtacccgttgg
gtgaaagctggaaagactgcaggacctgactgtaacttcagagtaactgatgtcattgaa
ggaacagaggtccagtttcaggttcgggctgaaaatgaagctggagttggccacccaagt
gaacccacagaaatcctatccattgaagatccaacaagtcctccctcaccaccccttgac
ctacatgtgactgatgctgggagaaaacacattgccattgcttggaagcctccagagaaa
aatggtggaagtcctatcataggataccatgttgaaatgtgtccagtaggcactgagaaa
tggatgcgagttaattctcgcccaataaaggacttgaaattcaaggttgaagaaggtgtt
gttcctgacaaagaatatgtcctgagagtgagagcagtcaatgctattggtgtcagcgag
ccatctgaaatctctgaaaatgtggttgccaaagacccagactgcaagccaacaattgac
ctggagactcatgacattattgttattgaaggtgaaaagttaagcattcctgttcccttc
agagctgtcccagttccaactgttagttggcataaagatggcaaagaagttaaagcaagt
gatagattaacaatgaagaatgatcacatctcagcccaccttgaagttcccaagagtgtc
catgcagatgccggagtttataccattacactggagaataagctcggctcagcaacagcc
tcaatcaatgtcaaagtcataggcctacctggaccatgcaaagatattaaagcaagtgac
attaccaagagttcttgtaagttaacctgggaacctccagaatttgatggtggaacccca
attcttcattacgtcctggagcgcagagaagctgggagaagaacatatataccagtcatg
tctggtgagaataaactgtcatggactgtgaaggatctcataccaaatggtgaatacttc
ttccgtgttaaagcagtcaacaagattggtggaggagaatatattgaactgaaaaatcca
gtcattgcccaagatccaaagcaaccccctgatccacctgtagatgtagaggttcataat
cctacagcagaggcaatgactattacatggaagccacctttgtatgacggaggaagcaag
ataatgggctacatcatagagaagattgctaagggtgaagaaaggtggaagagatgcaat
gaacacctggtaccaatcctgacctatacagcaaaaggacttgaagaggggaaagagtat
caattccgtgtgcgagcagagaacgccgcgggtattagtgaaccttctcgggctactcct
ccaaccaaagctgtagatcccattgatgcccccaaagtcattctgagaacaagcctagaa
gtgaaacgaggtgatgaaatagcacttgatgcaagtatttctggatcaccttacccaact
attacatggataaaggatgagaatgctattgtaccagaggaaattaagaagcgtgcagca
cccttggttagaagaaggaagggtgaagttcaagaagaagaaccatttgtcctgcctctg
acacagcgtttgagtattgacaacagcaaaaagggagaatctcagctacgcgtccgagat
tctctccgacctgaccatggtctgtatatgatcaaagttgaaaatgaccacggtatcgca
aaagctccttgtactgtcagtgtgttagatacaccgggaccaccaatcaactttgtattt
gaagatatcagaaagacctcagtcctttgtaaatgggaaccaccccttgatgatggtggc
agtgaaatcataaactacactttggaaaagaaagacaagacaaaacctgactcagaatgg
atagttgtcacttcaacacttagacattgcaaatattcagtaacaaaactgattgaagga
aaagagtacctcttccgtgtaagagctgaaaatagatttgggccaggtccaccatgtgtt
tcaaagccacttgtagctaaagatccatttgaaccacctgatgcaccagataagcccatt
gtggaagatgttaccagcaacagtatgctagtgaaatggaatgaaccaaaagataacgga
agccccattttgggttactggcttgaaaaacgtgaggttaatagtacacattggtctcgt
gtcaacaaaagccttctgaatgccttgaaagccaatgtagatggcttattagaaggactc
acctatgtcttcagagtatgtgctgaaaatgcagctggacctggaaagttcagtccacct
tcagatcccaaaacagcacatgatccaatctctccgcctgggccacctatcccaagagtc
actgacacaagctctacgactattgaactagaatgggaacccccagctttcaatggcggt
ggggaaattattggctattttgttgataagcagttggttggcacaaatgaatggtcacgc
tgcacagagaagatgatcaaggtccgtcagtacacagtcaaagaaatccgagagggtgct
gattataaacttcgggtgagtgccgtcaatgtcgcaggggaaggaccgcctggagaaaca
gaacctgttactgtggctgaaccacaagagcctccaactgtggaactggatgtttctgtc
aagggtggaatacaaataatggctgggaagactcttagaattccagctgtggtaacgggt
cgtcctgtacctacaaaagtatggaccaaagaagaaggggagctggataaagaccgcgtt
gtaatagacaatgttggaaccaaatctgaactaattatcaaggatgcactgcgaaaagac
catggcagatatgtgattacagctacaaatagctgtggttccaaatttgcagcagccagg
gtagaagtttttgatgtccctggtccagttcttgatttaaaacctgttgtaacaaacaga
aaaatgtgtctacttaactggtctgatccagaagatgatggaggaagtgaaataacaggc
ttcatcattgaaagaaaagatgccaagatgcatacttggagacaaccaatagagactgag
agatctaaatgtgacatcacaggtctgcttgagggacaagaatataagttccgtgttatt
gccaagaacaagtttggctgtggccctcctgttgaaataggaccaattcttgcagttgat
ccactaggtcctccaacatctccagagaggctgacatacactgaaaggacaaagtccact
atcacccttgactggaaagagccccgcagtaatggtggcagtcccatccaaggatatatc
attgaaaaacggcgtcacgacaaacctgactttgaaagagttaacaagcgactctgccca
actacatctcttctggttgaaaatcttgatgaacaccaaatgtatgagttccgtgtcaaa
gctgtcaatgaaattggtgaaagtgaaccatccctgcctcttaatgtagtcatacaagat
gatgaagtgcctccaactattaagttgcgtctgagtgttcgaggagacactatcaaagtt
aaggcaggagagcctgtccacatccctgcagatgtgacaggccttccaatgcctaagatt
gaatggtccaaaaatgaaaccgtaattgaaaaacccactgaggcacttcagataaccaag
gaagaggtatcccgaagtgaggcaaaaactgagcttagcattcccaaagcagtccgggaa
gacaaaggcacttacacagttactgcttccaatcgccttggctcagtgttccgaaatgtt
cacgttgaagtatatgaccgcccatccccaccaagaaaccttgctgttactgacattaaa
gctgaatcttgctacttgacatgggatgcccctcttgataatggtggcagtgaaatcacc
cattatgttattgacaaacgtgatgcaagtaggaagaaaacagaatgggaggaagtcacc
aacactgctgtagagaaaagatatgggatctggaaactgatccccaatggtcagtatgag
ttccgagtcagggcagtgaataaatacggaatcagtgatgagtgcaaatcagataaagta
gtcattcaagatccttatcgccttcctggacctccaggaaaaccaaaagttttggcacgc
accaaaggatcaatgctagtgagctggactcctcctttggacaatggtggctctccaatt
actggctactggctggagaaaagagaagagggaagtccttactggtcacgtgttagccga
gcaccagtaaccaaagtaggattgaaaggcgtggaatttaatgttcctcgtttgattgaa
ggcgttaaataccagttcagagccatggcaataaatgctgcaggaattggtcctcccagt
gaaccatcagatccagaggttgcaggagatcccatatttccaccggggccaccttcttgc
ccagaagtaaaagataaaacaaagtcaagcatctcactaggatggaaacctccagccaaa
gacggtggcagcccaatcaaaggatacattgtagaaatgcaagaagaaggtactactgac
tggaaaagagtaaatgaaccagacaaacttataactacctgtgaatgtgtggtgcctaat
ctgaaagagctcaggaagtacagattcagagtgaaagctgtcaatgaagctggtgaatct
gaaccaagtgatacaaccggggagatccctgccactgatattcaagaggaaccagaggtt
ttcattgacattggagcacaggactgtctggtttgtaaagctggctcacagattaggatt
cctgctgtcatcaagggacgcccaacaccaaaatcatcttgggaatttgatggaaaggca
aagaaagcaatgaaggatggagttcatgacatacccgaagattcacagctcgagactgct
gaaaactcctcagtaattattattccggagtgtaaacgatctcatacaggcaaatacagc
atcacagccaagaataaagcaggacaaaagactgcaaattgcagagttaaagtcatggat
gtaccaggcccacccaaagatctgaaagtcagcgatatcacaaggggtagttgcagactt
tcatggaagatgccagatgacgatggaggagacaggatcaaaggctatgttatcgagaag
agaactattgatggaaaagcctggaccaaagtcaatccagactgtggaagcaccacattt
gtagtgcctgatctcctctctgaacagcaatatttcttccgtgtgcgagcagaaaaccgt
tttggtattggcccacctgtggaaaccattcagaggaccactgccagagatccgatatat
cctcctgatcctcctattaaactcaaaattggcctcatcacaaagaacacagtgcatctg
tcatggaaacccccaaagaatgatgggggctcccctgttacccactatattgttgagtgc
cttgcatgggaccctactggaacaaagaaagaagcctggaggcagtgcaataagcgtgat
gtggaagaactgcaatttactgttgaagacctagtagagggtgggcaatatgaattccga
gtcaaagctgtcaatgctgcaggagtcagcaagccttcagccactgttggccccgtgact
gtcaaagaccagacatgcccaccatcaatcgatctaacagaattcatggaggttgaagaa
ggaactgatgttaacattgtggccaaaattaaaggtgtgccattcccaacactaacctgg
tttaaagctcctccaaagaagcctgataacaaagaacctgttctctatgacacccatgtc
aacaaactggtggtggatgatacttgcactttagttattccacagtctcgcaggagtgac
actggcttatataccatcacagctgtaaataatctgggaacagcatcaaaggagatgaga
ctgaatgtcctgggtcgtcctggccccccagtgggacccataaaatttgaatctgtttca
gcagagcaaatgacactgtcttggcttccacctaaagatgatggtgggtctaagattaca
aactatgtaattgagaaaagagaagctaacaggaagacatgggtccgtgtctccagtgaa
cctaaagagtgcacgtacacgattcccaaattgctagaaggccatgaatacgtattccga
atcatggcccagaataaatatggcattggagaacctcttgacagtgaacctgaaacagca
agaaacctcttctctgtccctggagcaccagataaaccaacagttagcagcgtgactcgt
aactccatgaccgtcaactgggaagagccagaatatgatggaggctctcccgtgacaggg
tactggctggaaatgaaagacactacttcaaagagatggaagagagttaaccgagatcct
atcaaagccatgactctgggtgtttcttataaagtgactggtcttattgaaggttctgac
tatcaattccgggtatatgcaatcaatgctgctggtgtgggtccagcaagtctgccatca
gatccagtgactgctagagatccaattgctcctcctggtcctccatttcccaaagtgaca
gattggactaaatcatctgcagatctggagtggtctcccccactaaaagatggtggatcc
aaagtaactggatacatcgttgaatataaagaagaaggaaaagaagaatgggaaaagggt
aaagataaagaagtgagaggaacaaagcttgttgtgacaggattaaaggaaggcgcattc
tacaaatttagagttagagcagtcaacattgctggcattggagaacctggagaggtcaca
gatgtcattgaaatgaaagacagacttgttttacctgaccttcagctagatgccagtgtc
agagatagaattgtcgtccatgctggaggagtgatccgaatcattgcctatgtgtctgga
aagcctcctccaaccgtcacctggaacatgaatgaaagagccttacctcaagaagccacc
attgagaccacagctattagctcatccatggtcatcaagaactgccagaggagccatcaa
ggcgtctattctcttcttgccaaaaatgaagccggagaaagaaagaagacaattattgtt
gatgtattagatgttccgggtcctgttggaacaccattcctagctcacaacctaaccaat
gagtcctgcaaactgacatggttttctccagaagatgatggaggctctccaatcaccaat
tatgtcattgaaaagcgtgaatctgaccgcagagcatggaccccagtgacatatacagtt
acccgacaaaatgctactgtccagggtctcattcaaggaaaagcctactttttccgagtc
gcggctgaaaatagtattggcatgggtccatttgttgagacatcagaggcacttgttatc
agagagccaataactgtaccagaacgtcctgaagacctggaagtcaaagaagttactaaa
agtactgtaactttgacttggaatcctcctaagtatgatggcgggtcagaaattattaac
tatgtcctagaaagtcggctcattggaactgagaagttccacaaagttacaaatgacaac
ttgcttagcagaaaatacactgttaaagacttaaaagaaggtgatacctatgagtaccgt
gtcagtgctgtcaacattgttggacaaggcaaaccatcattttgcaccaagccaattact
tgcaaggatgagctggcacccccaacacttcacctcgacttcagagataagctcacgatt
cgagttggtgaagcttttgccctcactggccgttactcaggcaaaccaaagcctaaggtt
tcctggttcaaagatgaagctgatgtgctggaagatgatcgcactcacataaagactaca
ccaacaacacttgctttagagaagatcaaggccaaacgttcagattccggcaaatactgt
gtggttgtggagaatagtacaggctctaggaaaggtttctgtcaagttaatgttgttgac
cgtcctggtccaccagtaggaccagttatttttgatgaggtgaccaaagattacatggtt
atctcttggaagcctcctttagatgatggaggcagtgaaatcaccaattatattattgag
aagaaggaagtgggtaaagacgtctggatgcccgtgacatctgcaagtgctaaaacaaca
tgcaaagtttctaaactacttgaaggaaaagattatattttccggatacatgctgaaaat
ctgtatggaataagtgatcctctggtgtctgattcaatgaaagccaaagatcgtttcagg
gttcctgatgcacctgatcagccaattgttacagaagttaccagagacactgcattagta
acctggaacaagccacatgatggaggaaaacccatcacaaactatatcctggaaaagaga
gaaactatgtctaaacgatgggctagagttaccaaagatcctattcatccgtacactaaa
tttagggttcctgatcttctagaaggatgtcagtatgaattccgggtttctgcagaaaat
gaaattggtattggagatccaagcccaccatccaaaccagtctttgctaaagatccaatt
gctaaaccaagtccacctgttaatcctgaagcaatagatacaacatgcaattcagtcgat
ctaacttggcagccaccacgtcatgatggtgggagcaagattctgggttatatagttgag
taccagaaagttggagatgaagagtggagaagagccaatcacacccctgagtcatgtcct
gaaactaaatataaagtcaccggtcttcgggacggtcaaacctataagttcagagtgtta
gcagtcaatgaagctggtgaatcagatccagctcatgttccagagccagtcctagtaaaa
gatagacttgaaccccctgagttgattcttgatgccaacatggcaagagaacaacacatt
aaggttggtgatactctaagacttagtgccatcatcaaaggagtgccattcccaaaagta
acttggaaaaaagaagacagagatgctccaactaaagcaagaattgatgtgactccagtt
ggtagcaagcttgaaattcgtaatgctgcccatgaagatggtggaatttattctttaaca
gtggagaatccagctggttcaaaaactgtctcagtaaaagtacttgtattagataaacct
gggccacctagagatctggaagtcagtgaaattaggaaagattcttgttaccttacttgg
aaagaaccactggatgatggtggttctgttattaccaattatgtggttgagaggagagat
gttgccagcgcccagtggtcatctctctcagctacatcaaagaaaaagagtcacttggct
aaacatctgaatgaaggcaaccagtacctcttccgagtagctgcagagaaccagtatgga
cgtggtccttttgttgaaacaccaaaaccaatcaaggctctggatcctctccatccccca
gggccacccaagaacctgcaccatgtagatgttgacaagactgaagtctccctcgtctgg
aataagccggatcgtgatggtggttctccaatcactggatatttggtggaatatcaagaa
gaaggcaccgaggactggattaaatttaagactgtgacaaacttagagtgtgtggttacc
ggactacaacaaggaaagacctatagattccgtgtaaaagctgaaaatattgtgggtctt
ggtctccccgacacaactatcccgatagaatgtcaagaaaaactagtgcctccatctgtg
gagctagatgtgaaattaattgaaggtcttgtggtaaaggctggaaccacagtcagattc
cctgctattataagaggtgtgcctgttcctaccgcaaagtggacaaccgatgggagtgag
attaaaaccgatgagcactacacagttgaaacagacaacttctcatcagtacttaccatt
aagaactgcttaaggagagacactggagaatatcaaatcacagtttccaatgcagctggt
agcaaaacagtagccgtacatcttactgttcttgatgttcctgggccaccaacaggtcct
attcatattctggatgttactcctgaacacatgactatctcatggcagccacctaaggat
gatggaggaagccctgtgataaattatattgttgagaaacaagatacaaggaaagacact
tggggtgttgtctcttcgggaagcagtaagacaaagctgaaaatcccacatctgcagaag
ggctgtgaatatgttttccgagttaaagcagagaataagataggtgttggtcctcccctt
gactccacacctactgttgctaagcataaatttagtcctccatctcctcctggtaaacca
gtggttactgacattactgaaaatgcagcaacagtgtcttggaccctgccaaaatctgat
ggtggcagtccaataactggctactacgtggaacgtcgagaagtaactggcaaatgggtg
agggtcaacaaaacacctattgctgaccttaagttcagagtgactggactctatgaagga
aatacatacgagtttagggtttttgctgaaaatcttgcaggactaagcaatccatcccca
agttccgatccaataaaagcttgccgtcccatcaaaccacctggaccacctattaatcct
aaactgaaagacaagagcagagaaacagctgatttggtgtggacaaagcctctcagtgat
ggtggtagccccattctaggatatgtagtggaatgtcagaaacctggcacagcacaatgg
aacaggattaataaagatgaactcattaggcaatgtgcctttagagtacctggactaatt
gaaggaaatgagtacagattccgtataaaggcagctaatattgtaggagagggtgagcca
agagaactagcagaatctgtgattgcaaaagatatccttcatcctccagaagtagaactt
gatgttacttgtcgtgatgttattaccgtgagagtaggccaaactatccgcattctagct
cgagtcaaaggcagacctgcaccagacataacttggactaaggaaggcaaagtattggtc
cgagaaaagagggtggacattattcaggacctacctcgtgttgagttacaaattaaagaa
gctgttagagctgatcatggcaagtatatcatctcagctaagaacagcagtggacatgcc
caaggttcagccatcgttaacgtccttgacagacctgggccttgccagaatttgaaggtt
accaatgtaaccaaagagaactgtacaatttcttgggaaaacccactagataatggcggc
tcagaaataacaaacttcatagtagaatatcgcaaaccaaaccagaaaggctggtcaatt
gttgcgtcagatgtcactaaacgattaatcaaggccaaccttttagccaacaatgaatac
tatttccgagtttgtgcagagaataaagtaggtgttgggccaaccatcgaaacaaaaact
cccattctggctattaaccctattgacagaccaggtgagcctgaaaaccttcacattgcg
gataaaggaaagacatttgtctacctaaagtggcggaggcctgattatgatggtggcagt
ccaaatctgtcatatcatgttgagagaaggctgaagggctctgatgactgggaaagagtg
cataaaggaagcattaaagaaactcactacatggttgacagatgtgttgaaaaccagatt
tatgagttcagagtgcaaacgaagaacgaaggtggggaaagtgactgggtgaagacagag
gaagttgttgttaaagaagacttacaaaaaccagtacttgatctgaaattaagtggggtc
ctaactgtcaaagcaggggacaccattaggcttgaggcaggggttagaggcaaaccattc
ccagaagtttcatggaccaaggacaaagatgctacagactttacaagatcaccaagggtc
aagattgataccagtgctgattcatctaaattttctcttactaaagcaaagcgaagtgat
gggggtaaatatgtagttacggcaactaacacagctggcagttttgtggcctatgccact
gtcaacgttttagataagcctggtcctgtgagaaatctgaaaattgttgatgtgtccagt
gataggtgtactgttcgctgggatccaccagaagatgatggcggctgtgaaatccaaaat
tatattctagaaaaatgtgagacaaagcgaatggtttggtctacctattctgctactgtc
ttgacacctggtactacagtaacacgtctcatagaaggaaatgaatatattttcagagtc
cgtgcagaaaataaaataggcacagggcctccaacagaaagtaaaccagtcatagccaaa
accaagtataataaacctggacgccctgatcccccagaagtcactaaagtaagcaaagaa
gagatgactgtggtttggaatccacctgaatatgatggtggaaagtctataacaggatac
tttttggagaaaaaggaaaagcattcaacacgatgggtccctgttaacaagagtgcaatc
cctgagagacgtatgaaagtacagaatctcctcccagaccatgaatatcagttccgtgtc
aaggcagaaaatgaaattggaattggagagccaagcttgccttcaagaccagtggtggca
aaagaccccatagagccacctggtccaccaaccaatttcagagtggttgatacaaccaaa
cattccataactcttgggtggggaaaaccagtctatgatggtggtgcaccgatcattgga
tatgttgtggaaatgagaccaaaaatagcagatgcatctcctgatgaaggctggaaacgt
tgtaatgctgcagcacagcttgtacgcaaggaattcaccgttaccagcttggatgaaaac
caggaatatgagttcagggtgtgtgcccaaaaccaagttggtattgggcgccctgcagag
ctaaaggaagctatcaaacctaaagaaatactagaacctccagagattgatttggatgcc
agcatgagaaaactggtcatagtgagagcaggatgccctattcgtctctttgctatagta
agaggacgaccagcccctaaagtcacttggcgaaaagtgggcattgataatgtggtcaga
aaaggacaagttgatctggttgacactatggccttccttgtcatccccaattctactcgt
gatgactcaggaaaatattccttaacacttgtgaacccagcaggagaaaaggctgtattc
gtaaatgtcagagtattagacactcctggacctgtgtctgatttgaaagtttcagatgtc
actaaaacatcatgccatgtgtcctgggcccctcctgaaaatgacggtgggagccaagtg
acacattatattgtggagaaacgtgaggcagacagaaagacatggtcaaccgttacccca
gaggttaagaaaacaagcttccaagtaaccaatcttgtccctgggaatgagtattacttc
agagtaactgctgtcaacgaatatggccctggcgtcccaacagatgtcccaaaaccagtg
cttgcatcagatcctctaagtgagccggatcccccaaggaaattagaagtgactgaaatg
acaaagaacagtgccaccttagcctggttacctcccctgcgtgatggaggtgctaaaatc
gatggctacatcattagttacagagaagaagagcagcctgcagaccgctggacagagtac
tcagtggtaaaagatctcagccttgttgtcactggcctaaaggaaggaaagaaatacaaa
tttagagtagcagccagaaatgctgttggagtcagtttgccaagagaagctgaaggagtg
tatgaagccaaagaacaactgttgccaccaaagatccttatgccagagcaaattactatc
aaagctgggaaaaaactccgaattgaagcccatgtgtatggaaagcctcatcccacctgt
aaatggaaaaaaggagaagatgaagttgtcacatccagccacctggcagtgcataaagca
gacagctcttcaattctgatcataaaagatgtgactagaaaagacagtggttactacagc
ctcacagcagagaacagttctgggacagacactcagaaaatcaaagttgtagtcatggat
gcccctggcccccctcagcctccatttgacatttctgatatagacgccgatgcttgctcc
ctgtcgtggcacatccctctggaggacggaggcagtaacatcaccaattatatagtggag
aagtgtgatgtaagccgaggtgactgggtcacggctctagcttcagtcacaaaaacttcc
tgcagggttggaaagctgatcccaggccaggagtacatcttccgggtccgtgctgaaaac
cgatttggcatttcagagcctctcacatctccaaagatggttgcagagttcccatttggt
gttcctagtgaaccaaagaatgcacgagtcaccaaagtcaacaaggactgtatttttgtt
gcatgggacagaccagacagtgatggagggagccccattactggttatctgattgaacgc
aaggaaagaaacagtttgctgtgggtgaaagccaatgatactcctgtccggtcaactgaa
tatccttgtgctggccttatagaaggtcttgagtattcatttagaatctatgccctaaac
aaagctggatccagcccacccagcaaacccacagaatatgtaactgcaagaatgccagtt
gatcctcctgggaaacctgaagttattgatgtcaccaagagtactgtatctctgatctgg
gcacgtccaaagcatgatggaggcagtaaaattattggttatttcgtagaagcttgcaaa
cttcctggtgataaatgggtacggtgcaatactgcacctcaccagattccccaggaagag
tacacagctactggcctagaagagaaagctcagtatcaatttagagctattgccaggacc
gcagtaaacattagcccaccttcggaaccttctgatccagtgactatcctcgcagaaaat
gtccctcccaggatagacctgagtgtggctatgaaatcactgcttactgtgaaagctgga
actaatgtctgcttggatgctactgtttttggtaaaccaatgccaacggtttcttggaag
aaagatggcacactgctaaaaccagcagaaggcataaagatggccatgcagcggaatctg
tgcaccttggagctattcagcgtgaaccggaaggactcgggagactataccattactgct
gaaaattcaagtggttctaagtcagccaccattaagcttaaagtgttagataaaccgggt
cctccagcatctgttaaaatcaacaaaatgtattcagatcgtgcaatgctttcttgggaa
ccgcctcttgaagatggaggctcagaaatcaccaactatattgttgacaaacgtgaaaca
agcaggcccaactgggctcaagtctctgcaactgtgcctatcaccagctgcagcgtggag
aaacttatagagggccatgagtatcagttccgtatttgtgctgaaaataaatatggagta
ggcgatccagtcttcactgaaccagcaattgccaaaaacccatacgacccaccaggacgc
tgtgatcctcctgttattagcaacataaccaaagatcacatgacagtcagctggaagcca
ccagcagatgatggcggctcacccatcactggctatttgcttgaaaagcgggaaacccag
gctgttaactggactaaggtcaacagaaaacctattatagaaagaacactaaaagcaaca
ggtcttcaagaaggtaccgaatatgagttccgtgttacagctataaataaagctggacca
ggcaaacccagtgatgcatccaaggccgcttatgctcgggaccctcagtatcctcctggc
ccaccggctttccctaaagtatatgatacaactcgtagctccgtgagtctatcctggggc
aagccagcctatgacggcggcagccctatcattggttatctcgttgaagtaaaacgggct
gactccgataactgggtgaggtgcaacttaccacagaatctacagaaaacccgctttgag
gttactggcctgatggaagacacacaatatcaatttcgtgtgtacgccgttaataagatt
ggatacagtgaccccagtgatgtgccagataaacactaccccaaggacatcttaattcca
cctgagggagaacttgatgcggacttaaggaagacactcatattacgtgctggagttact
atgagactatatgtaccagtaaaaggacgcccacctccaaagattacttggtctaaacct
aatgtcaatctaagagacaggattggactggacataaagtcaactgactttgacactttc
ttgcgctgtgaaaatgtgaacaaatatgatgcaggaaaatacatcttaaccctggagaac
agctgtggtaaaaaggaatataccattgttgtgaaagtgcttgatactcctgggccacct
gtcaatgtgactgttaaggaaatatccaaagactctgcttatgttacctgggagcctccc
attattgatggtggaagccccatcataaactatgtggtacaaaaacgtgatgcagagagg
aaatcctggtctacagtgacaactgagtgctccaaaacgagcttcagagtatctaatttg
gaggagggaaaatcctacttcttccgagtgtttgctgaaaatgagtatggcattggtgat
cccggtgaaactcgtgatgctgtcaaagcttcccaaactcctggaccagttgtggacctg
aaagtgaggtctgtaactaagtcatcttgtagcattggctggaaaaagcctcatagtgat
ggtggaagtcggattattggatatgtagttgatttcctgactgaagaaaataagtggcaa
cgagttatgaaatccttaagcctacagtactccgcaaaagatctgactgaagggaaggaa
tataccttcagagtgagtgctgagaatgaaaatggagaaggaaccccaagcgaaatcact
gttgtggcaagggatgatgttgtggctcctgatcttgacttaaagggtctacctgatttg
tgctacttggctaaagaaaacagcaacttccggcttaagatccccataaaaggcaagcca
gctccatcagtctcctggaagaaaggggaagatcctctagcaactgacactagagtcagt
gttgagtcatctgcagttaacacaactcttatagtatacgattgccaaaaatctgatgct
ggaaaatacacaatcacacttaagaatgttgctggcaccaaggaaggaactatctccata
aaggttgttggcaagcctggcatccccactggaccaatcaaatttgatgaagtcacagca
gaagccatgaccttaaagtgggctcctccaaaggatgatggaggttctgaaatcaccaac
tatatcctagagaagagggattctgtgaacaacaagtgggtgacgtgcgcctcagctgtc
cagaaaaccacctttagagtaaccagacttcatgagggcatggaatataccttcagggtc
agtgccgaaaataaatatggtgtaggggaaggcctgaaatcggagccaattgttgctaga
catccatttgatgtgcctgatgctcccccacctcccaatattgtggaggtcagacacgat
tcagtatctctaacttggactgaccccaggagaactggtggctctccaattacagggtat
catctggagttcaaggaaagaaacagccttctgtggaagagagctaacaagactccgata
aggatgagagactttaaagtgacaggattaactgaaggtcttgaatatgaattccgagtt
atggcaatcaatttagcaggtgtgggcaagccaagcctcccatcagagcctgtcgtggca
ctggacccgattgatcctcctggaaaacctgaggttattaacgtaacaaggaattcagtg
actctcatttggactgaacctaaatatgacggtggtcataagttaactggctatatagtg
gagaagcgagatctaccttccaagtcttggatgaaagccaaccatgttaatgtcccagaa
tgtgcctttactgtaactgaccttgttgagggtggaaaatatgaattcagaattagagca
aagaatacagcaggtgctatcagtgctccatcagaaagtacaggaaccattatttgcaag
gatgaatacgaggcaccaacaattgtccttgatcccacaataaaagatgggctaacaatt
aaagcaggggataccattgttttgaatgccattagcattcttggcaaaccccttccaaaa
tcaagttggtccaaggcaggaaaagacattagaccatcagatatcactcagataacttca
accccaacatcttccatgcttactatcaagtatgccactagaaaagatgccggtgaatac
accatcactgctaccaatccttttggcacgaaggaggaacatgtgaaggtaacagtcctt
gatgtacctggtcccccaggtcctattgaaatcagtaatgtttctgctgaaaaagcaaca
cttacatggacacctcccttggaagatggcggctcaccaattaagtcctatatacttgaa
aagagagaaaccagtcgacttttgtggacagtggtttctgaagatattcagtcttgcagg
catgtggcaaccaaacttatccaaggaaatgagtacgtcttccgggtctcagctgtaaac
cactatggcaaaggagaacctgtacagtctgaacctgtcaaaatggtagacagatttggt
ccccctggccctcctgaaaaaccagaggtctcaaatgtcactaagaacactgccactgtc
agctggaaaaggccagtggatgacggtggcagcgaaatcacaggatatcatgtagaaagg
agagaaaagaaaagcctgcggtgggtgagagcaataaaaacgccagtttctgatctcaga
tgcaaagtaacaggactgcaagaaggaagcacctatgaattccgtgtcagtgcagaaaac
agagcaggaattggtccacccagtgaggcttcaaattctgttctaatgaaagatgcagca
tatcctccaggaccaccttcaaatccgcatgtcactgatacgaccaagaaatctgcttct
ttggcatggggcaagcctcattatgatggtggacttgaaatcactggctatgttgtggag
catcaaaaagtaggagacgaggcctggataaaagataccacaggaactgccctcagaatc
actcagttcgttgttcctgatcttcagactaaagaaaaatacaactttagaatcagtgcc
atcaacgatgcaggtgttggggagccagcggtgattccagatgttgaaattgtagaacgg
gaaatggctcctgattttgaactagatgccgagcttcgaagaacacttgttgttagagca
ggactcagtattagaatatttgtgccgattaaaggtcgtcctgctcctgaagtgacatgg
accaaagataacatcaacctgaaaaaccgagccaacattgaaaatacagaatcatttact
cttctgattatcccagaatgtaacagatatgataccggtaaatttgtcatgaccattgaa
aacccggctgggaagaaaagtggctttgtgaatgtcagagtcttggacacgccaggccca
gtcctcaacctgcggcctacagacatcacaaaggacagtgtcaccctgcactgggacctc
cctctgatagatggaggctcacgtataacaaattacattgtagagaaacgtgaagcaaca
cggaaatcttattccacagtcaccactaagtgccataaatgcacatataaagttaccggc
ttgtctgaagggtgtgaatacttcttcagagtgatggcagagaatgaatatggaattggt
gagccaagagaaactacagagcctgtaaaagcctctgaagcaccatctccaccagacacc
cttaacatcatggacataactaagagcactgtcagcctggcatggcctaagcccaaacac
gatggtggcagcaagatcactggctatgtgattgaagcccaaagaaaaggctctgaccag
tggacccacatcacaaccgtgaaagggttagaatgtgttgtgaggaatctaactgaagga
gaggaatacaccttccaagtgatggcagtgaacagcgcggggagaagtgcccctagagaa
agcagacccgtcattgtcaaggagcagacaatgcttccagagctggatctccgtggcatc
tatcagaaactggtcattgccagagctggtgacaacatcaaagttgaaattccagtgctc
ggtcgacccaagcccacagtgacatggaaaaaaggagaccaaattcttaaacagacacag
agagttaattttgaaaccacagcaacttcaaccattttaaatatcaatgagtgtgtcaga
agtgatagtgggccctatccattaacagcaaggaacattgtaggagaggttggtgatgtc
atcaccattcaagtccatgatatcccagggccacctactggaccaatcaaatttgatgaa
gtttcatctgattttgtaaccttctcttgggatccccctgagaacgatggtggtgtacca
ataagcaactacgtagtggagatgcggcagactgacagtactacctgggttgagttagca
accaccgttatacgtactacctataaagccacccgccttactactggattagagtatcag
ttccgtgtaaaagctcagaatagatatggagtcggaccaggcatcacatcagcatgtata
gttgccaactatccatttaaggttcctggacctcctggtacccctcaggtaactgcagtt
accaaggattcaatgaccattagctggcatgagccactttctgatggtggaagccctatt
ttaggatatcacgttgaaagaaaagaacgaaatggtattctctggcagactgtgagcaaa
gctttagtaccaggcaacattttcaaatcaagtggacttacagatggtattgcttatgaa
ttccgggtgattgcagaaaacatggcaggcaaaagcaagccaagcaagccatcggagcct
atgttggctctggatcccatcgacccacctggaaaaccaatacctctaaatattacaaga
cacacagtgacacttaaatgggctaagcctgaatatactgggggctttaaaattaccagt
tatattgttgaaaagagagaccttcctaatggacggtggctgaaggccaacttcagcaac
attttggagaatgaatttacagtcagtggcctaacagaagatgctgcatatgaattccgt
gtgattgccaaaaatgctgcaggtgccatcagtccaccttctgagccatctgatgctatc
acttgcagggatgacattgaagcaccaaagataaaggtggatgttaaatttaaggacaca
gttatattaaaagcaggtgaaacattcagactggaagctgatgtttcaggccgcccacct
ccaacaatggaatggaccaaagatggaaaagagctggaaggcacagcaaagttagaaata
aaaattgcagatttctctactcatctggtaaacaaagattcaacaagaagggatagtggt
gcctatacccttacagcaactaatcctggtggctttgctaaacacattttcaatgtcaaa
gttcttgacagaccaggcccacctgaaggacctttggctgtaactgaagtgacatcagaa
aagtgtgtactatcatggttgcctccactggatgatggaggtgccaaaattgatcattac
atagtacagaaacgtgaaaccagcagattggcatggacaaatgtagcctcagaagtccaa
gtaacaaagctaaaggtcactaaactcttgaaaggcaatgaatacatattccgtgtcatg
gctgtaaataaatatggagtgggagagccactggaatcagagcctgtgcttgcagtgaat
ccttatggaccccctgatccgcccaaaaaccctgaagtgacagctattactaaagactcg
atggttgtctgctggggacatcctgattctgatggtggaagtgaaatcatcaattatatt
gtggaacggcgtgataaagctggccaacgctggattaaatgcaacaaaaaaactcttact
gatttaagatataaagtgtctggactgacagaaggacatgaatatgagttcaggattatg
gctgaaaatgctgctggaattagtgcaccaagtcctaccagtccattttacaaggcttgt
gacactgtgtttaaacccggaccaccaggtaacccacgtgttctagatacaagcagatca
tccatttcaatcgcttggaataaacctatctatgatggtggatcagaaatcactgggtat
atggttgagattgccctgccagaggaagatgaatggcagattgtcactccaccagcagga
ctcaaggcaacttcttatactatcactggcctcacagagaatcaggaatataagattcgc
atctatgccatgaattccgaaggacttggggaacccgcccttgttcctggaactccgaag
gctgaagacagaatgctgcctccagaaattgaactggatgctgacctgcgcaaagttgtt
acgataagggcctgctgcacgctgagactttttgttccaatcaaaggaaggcctgcacct
gaggtgaagtgggcccgggaacatggagaatctttagataaagctagcattgaatccaca
agctcttacacactgcttattgttggaaatgtaaacagatttgacagtggcaaatacata
ctaactgtagaaaatagttcaggcagcaagtctgcatttgtcaacgttagagttcttgat
acaccaggccctccacagaatctgaaggtaaaggaggtcactaagacatctgtcacactg
acatgggacccacctctccttgatggaggttcaaaaatcaagaactatattgttgaaaag
cgggaatcaacaagaaaagcatattcaactgttgcaacaaactgccacaagacttcctgg
aaggtagaccagcttcaagaaggctgtagctactatttcagggttctcgcagaaaatgaa
tatggcattgggctgcctgctgaaaccgcggaatctgtgaaagcatcagaacgacctctt
cctccaggaaaaataactttgatggatgtcacaagaaatagtgtgtcactctcttgggag
aagccagagcatgatggaggcagccgaattctaggctacattgtggagatgcagagcaaa
ggcagtgacaaatgggccacgtgtgccacagtcaaggtcactgaagccactatcactgga
ttaattcagggtgaagaatactctttccgtgtttcagctcagaatgaaaagggcatcagt
gatcctagacaactgagtgtgccagtgatcgccaaagatcttgtcattccaccagccttc
aaactcctgttcaatactttcactgtactggcaggtgaagacctaaaagttgatgttcca
ttcattggccgccctaccccagctgtaatctggcataaagatgatgtaccactgaagcag
acaactagggtaaatgcagagagcacagaaaataattcactactgacaataaaggatgcc
tgccgagaagatgttggccattatgtggttaaactgactaactcagctggtgaagctact
gaaacccttaatgttattgtccttgacaaaccagggcctccaactggaccagttaaaatg
gatgaagtgacagctgatagtattactctttcctggggcccacccaagtatgatggtgga
agttctatcaataattatattgttgagaaacgggacacttccacaaccacctggcaaatt
gtatcagctacagttgcaaggacaacaataaaggcttgcagactgaagactggatgtgaa
tatcagtttagaattgcagctgaaaacagatacggaaagagtacctacctcaattcagag
cctattgtagcccaatatccattcaaagttcctggtcctcctggcactccacttgtcaca
ctgtcctccagggacagcatggaagtacaatggaatgagccggtcagtgatggaggaagc
agagtcattggctatcatctagaacgcaaggaaagaaatagtatcctctgggttaagttg
aataaaacacctattcctcaaaccaagtttaagacaactggccttgaagaaggtgttgaa
tatgaatttagagtctccgcagagaacatcgtgggcattggcaagccgagtaaagtatca
gaatgttatgtggctcgtgacccatgtgatccaccaggacggccagaggcaatcattgtc
acaaggaattctgtgactcttcagtggaagaaacccacctatgatggtggaagcaagatc
actggttatattgttgagaagaaagaattacctgagggccgttggatgaaagccagtttt
acaaatattattgacactcattttgaagtaactggcctagttgaagatcacagatatgag
ttccgggttatagcccgaaatgccgcaggagtgtttagtgagccttcagaaagcacaggg
gcaataacagctagagatgaggtagatccaccacgaataagtatggatccaaaatacaaa
gacacaatcgtggttcatgctggtgaatcattcaagattgatgcagatatttatggcaaa
ccaataccaaccattcagtggataaaaggtgatcaggagctttcaaacacagctcgatta
gaaataaagagcactgactttgccaccagtctcagtgtaaaagatgcagtacgtgtcgac
agtggaaattacatactgaaggccaaaaatgttgcaggagagagatcagttactgtgaat
gtcaaggttcttgatagaccagggccacctgaaggacctgttgttatctcaggagttaca
gcagaaaaatgcacactagcttggaaacctccacttcaggatggtgggagtgatatcata
aattatattgtggaaaggagagaaaccagccgcttagtttggactgtggttgatgccaat
gtgcagactctcagctgcaaggttactaagcttcttgaaggcaatgaatatactttccgt
ataatggcggtaaacaaatatggtgttggtgaacctcttgaatctgagccagtaattgcc
aagaatccatttgtagtaccagatgcaccaaaagctccagaagtcacaacagtgaccaag
gactcaatgattgttgtatgggaaagaccagcatctgatggtggcagtgaaattcttgga
tatgttcttgagaaacgggataaagaaggcattagatggacaagatgccataagcgtctg
attggagagttgcgcctgagagtaactggactcttagaaaatcacaattatgagttcaga
gtttctgctgagaatgctgctggacttagtgaaccaagccctccttctgcataccaaaag
gcttgtgatcctatttataaaccaggacctccaaacaaccccaaagtcatagatattacc
agatcttcagtattcctatcttggagcaaaccaatatatgatggtggctgtgaaatccaa
ggatacattgttgaaaaatgtgatgtgagtgttggtgaatggacaatgtgcactccacca
acgggaattaataaaacaaacatagaagtagaaaagctgttggaaaagcatgaatacaac
ttccgtatctgtgctattaataaagctggagttggagaacatgccgatgtccctggacct
attatagttgaagaaaaattggaagcaccagacattgatcttgacctagaactaaggaaa
atcataaatataagggcaggtggctccttaaggttatttgttcctataaaaggtcgtcct
acaccagaagttaaatggggaaagatggatggtgaaattcgagatgcagctataattgat
gtcactagcagtttcacctctcttgttcttgacaatgtcaaccgatatgatagtggaaaa
tatacacttacattagaaaacagcagtggaacaaagtctgcctttgttactgtgagagtt
ctggacacgccaagtccacctgttaacctgaaagtcacagaaatcaccaaagactcagta
tcaattacatgggaacctcctttgttggatgggggatccaaaataaaaaattacattgtt
gagaaacgtgaagccacaagaaaatcatatgctgctgttgtaactaattgccataagaat
tcttggaaaatcgatgagctccaagaaggttgcagttattacttcagagtcacagctgag
aatgagtatggtattggccttcctgcccagactgctgatccaattaaggttgcagaagtc
ccacaacctcctggaaaaataactgtggatgatgtcaccagaaacagtgtctctctgagt
tggacaaaacctgaacatgatggtggcagtaaaatcattcagtatattgtggaaatgcaa
gctaaacacagtgagaaatggtcagagtgtgctcgagtaaagtctcttgaagcagtaatt
tccaacctaactcaaggggaagaatatctttttagagttgttgctgtaaatgaaaagggg
agaagtgaccctcggtcccttgcagttccaatagttgccaaagatctggtaattgagcca
gatgtaaaacctgcattcagtagttacagtgtacaggttggccaagatttgaaaatagaa
gtgccaatttctggacgtcctaagccaacaattacctggactaaagatggtctcccactg
aagcagaccacaagaatcaatgttactgattcactggatctcaccacactcagtattaaa
gaaactcataaggatgatggtggacaatatggaatcatggttgccaatattgttggtcag
aagacagcatccatcgaaattgtaactctagataaacctgatcctccaaaaggacctgtt
aaatttgatgatgtcagtgctgaaagtattacattatcttggaaccctccattatataca
gggggctgccaaatcaccaattacattgttcagaaaagagatacaaccaccacagtatgg
gatgttgtttctgctactgttgctagaactacactcaaagtgaccaaactgaaaactggt
acagaataccaatttagaatatttgccgaaaacagatatggacaaagttttgccttagaa
tctgatccaattgtagctcaatatccctacaaagaaccaggccctccaggtacaccattt
gccacagccatttccaaagactccatggtcatacagtggcatgaaccagtcaacaatggt
ggaagcccagtcataggttaccacctggagagaaaagaaagaaatagtattttgtggaca
aaggtcaacaaaactattattcatgacacccaattcaaagcacagaatcttgaagaaggc
attgaatatgaattcagagtgtatgcagaaaatattgttggtgtaggcaaagcaagcaag
aattctgaatgctatgtagccagagatccctgtgacccaccaggaaccccagaaccaata
atggttaaaagaaatgaaatcactttacagtggaccaaacctgtatatgatggtggaagt
atgattacaggctacattgtagagaaacgtgatttgcctgatggtcgttggatgaaagcc
agctttacaaatgtcattgaaactcaatttactgtgtcaggtcttactgaagatcaaaga
tacgaattcagagtcattgcaaagaatgccgctggtgcaataagtaaaccctctgacagt
actggaccaataactgccaaggatgaagttgaactcccaagaatttcaatggatccaaaa
ttcagagacacaattgtggtaaatgctggagaaacattcagacttgaggctgatgtccat
ggaaagcccctacctaccattgagtggttaagaggagataaggaaattgaagaatctgct
agatgtgaaataaagaacacagacttcaaggctttacttattgtaaaagatgcaattaga
attgatggtgggcagtatattttaagagcttccaatgttgcaggttctaagtcattccca
gtaaatgtaaaagtattagatagaccaggacctccagaagggccagtccaggttactgga
gtcacttctgaaaaatgctctttaacatggtctccaccacttcaagatggtggcagtgac
atttctcactatgttgttgaaaagcgagaaaccagtcgacttgcctggactgttgttgct
tcagaagttgtgaccaattctctgaaagttaccaaactcttagaaggtaatgaatatatt
ttccgtataatggctgtcaacaaatatggtgttggagagcctttggaatctgcaccagta
ctaatgaaaaatccatttgtgcttcctggaccaccaaaaagcttggaagtcacaaatatt
gccaaagactccatgaccgtctgttggaaccgtccagatagtgatggtggaagtgagatt
attggttacattgtagagaaaagagacagaagtggcattcgatggataaaatgtaataaa
cgccgcattacagatttgcgtctaagagtgacaggattaacagaagatcatgagtatgaa
ttcagggtctctgcagaaaatgctgctggagttggggaaccaagtccagctacagtttat
tataaagcctgtgatcctgtgttcaaacctggcccacccaccaatgcacacattgtagac
accaccaaaaattcaatcacacttgcctggggtaaacccatctatgacggtggcagtgag
atcctgggatacgtagtagaaatctgtaaagcagatgaagaagaatggcaaatagttact
ccacagactggcctaagagttactcgatttgaaatttcaaaactcactgaacaccaagag
tataaaatacgagtctgtgccctcaacaaagttggtttaggtgaggctacatcagttcct
ggtactgtgaaaccagaagacaaacttgaagcacctgaacttgaccttgactctgaatta
agaaaaggaattgttgtaagagctggtggatctgccagaattcacattccattcaaaggt
cgtccaacgcctgagatcacttggtctcgagaggaaggtgaattcacagataaggtccaa
attgaaaagggagtaaactatacccaactatcaatagataactgtgatagaaatgatgct
ggaaaatacattcttaagttggaaaacagcagtggatcaaagtctgcttttgtaactgtg
aaagttcttgacactccaggaccaccacagaatttggcagtcaaagaagtgagaaaagat
tctgtcctcctggtatgggagccacccatcattgatggaggtgcaaaggtcaagaactat
gtgattgacaaacgtgagtcaaccagaaaagcatatgctaatgtgagtagtaaatgcagc
aaaacaagttttaaagtggaaaatcttacagaaggagccatttattacttcagagtcatg
gctgaaaatgaatttggagttggtgttccagtggaaactgttgatgccgtgaaagctgct
gaacctccttccccaccaggaaaggttacactcactgatgtgtcccagaccagtgcatca
cttatgtgggagaaacctgaacatgatggtggtagcagaatcctggggtatgttgttgaa
atgcagcccaaaggaactgaaaaatggagcattgtggcggaatccaaagtctgtaatgca
gttgttactggtttgagttctggacaagaatatcagttccgtgtcaaagcttataatgag
aaaggaaaaagcgatccaagagtgctgggtgttcctgtcatagccaaggacttgactata
cagcctagtttaaagttaccatttaacacatatagtatccaagctggagaagatcttaaa
atagaaattccagttataggccgaccaagacctaacgtttcttgggtcaaagatggtgag
cctcttaaacagacaacaagagtaaacgttgaagaaacagctacctcaactgttttgcac
attaaagaaggtaacaaagatgactttggaaaatacaccataacagcaacaaatagtgca
ggcacagcaacagaaaatctcagtgttatcgttttagaaaagcctggacctccagttggc
ccagttcggtttgatgaagttagtgcagactttgtagtcatatcttgggaacctccagcc
tatactggtggctgccaaataagcaactacattgtagagaagcgagatacaaccaccacc
acttggcacatggtatcagcaacagttgcaagaacaacaattaaaataaccaaactgaaa
acaggcacggagtaccagtttagaatttttgctgaaaacaggtatggaaaaagtgcccca
ctggattctaagccagttattgtacagtatccatttaaagaacctggaccacctggaact
ccttttgtgacatcaatctcaaaagatcaaatgcttgtgcactggcatgagccagttcat
gatggaggcaccaaaattattggctaccatcttgaacagaaagaaaagaacagtatttta
tgggtcaagttaaataagacccccattcaggacaccaaattcaaaacaactgggcttgat
gagggccttgagtatgagttcaaagtttctgctgaaaatattgttggcattggcaagcct
agcaaagtgtcggaatgctatattgctcgtgatccatgtgacccacctggtcgccctgaa
gccattgttattacaagaaacaatgtcacactgaaatggaagaaacctgcctatgatggt
ggtagcaaaataacaggttaccttgtagaaaagaaagatctacctgatggccgctggatg
aaagccagctttaccaacgtattagaaactgaatttacagtgagtggacttgtagaagac
caaagatatgaatttagagtaattgcaagaaatgcagctggaaactttagtgaaccatct
gaaagtagtggtgccattactgcaagagatgaaattgatgcaccaaatgcctctctggat
ccaaaatataaagatgtcatcgttgttcatgcaggagagacttttgttcttgaagccgac
atccgtggcaaacctatacccgatgttgtttggtcaaaagatggaaaagaacttgaagaa
acagctgctagaatggaaattaaatctactattcagaaaacaactcttgttgtcaaagac
tgtatacggactgatggaggacaatatattctgaaactcagcaatgttggtggtacaaag
tctatacccatcactgtaaaggtacttgacaggccagggcctcctgaagggcctctgaaa
gttactggagttactgcagaaaaatgttacctggcatggaacccacctttgcaagatggt
ggtgctaatatttcacattacatcattgaaaagagggagacaagccgactctcttggacc
caggtttcaactgaggtacaggcccttaactacaaagttactaaacttcttcctggtaat
gagtacattttccgtgtcatggctgtgaataaatacggaattggagagcccttggaatct
gggcctgttacagcctgtaatccttataagccaccaggtcctccttcaacacctgaagtc
tcagcaatcaccaaagattctatggtagtaacatgggcacgcccagtagacgatggaggt
gctgaaattgagggctacattcttgaaaaacgagataaggaaggcgttagatggaccaag
tgcaacaagaaaacattaacggatctccggctcagggtaactggtcttaccgaaggccat
tcctatgaattcagagttgctgctgaaaatgcagctggtgtgggagaacctagtgagcca
tctgttttctaccgtgcatgtgatgccttgtatccaccaggtccaccaagcaatccaaaa
gtgacggacacttccagatcttctgtctccctggcatggagtaagccaatttatgatggt
ggtgcacctgttaaaggctatgttgtagaggtcaaagaagctgctgcagatgaatggaca
acttgtactccaccaacaggactacaaggaaagcagttcacagtgaccaagcttaaagaa
aatactgaatataacttccgtatttgtgccatcaattctgaaggtgtaggtgaacctgca
actctacctggttcagtggttgctcaggagaggatagagccaccagaaatagaactcgat
gctgatctcagaaaggtggtcgttctgcgtgcaagtgctactttacgcttatttgtcact
atcaaaggtcgaccagaacccgaagttaaatgggaaaaggcagaaggcattctcactgat
agggctcagatcgaggtgaccagctcatttacaatgttggtgattgataatgttaccaga
tttgacagtggtcggtataatctgacattagaaaataatagtggctccaaaacagctttt
gttaacgtcagagttcttgactcaccaagtgctcctgtgaatttgactgtaagagaagtg
aagaaagactcagtgatgttgtcctgggaaccgccacttattgatggtggagctaagatt
acaaactacattgttgaaaaacgagaaactacaagaaaagcctatgctactgttacaaac
aattgcactaaaactactttcagaattgaaaatctacaagaaggatgttcctactacttc
cgagtcttggcttccaatgaatatgggattggtttgccagctgaaacaacggaacccgtt
aaagtgtctgaaccacccctcccacctggaagagtaactcttgttgatgtgacccataat
acagctacaattaagtgggagaaaccagaaagtgatggtggcagcaaaattattggttat
gtggttgaaatgcagactaaagggagtgaaaagtggagcacctgcacacaagttaagact
ctagaagcaactatatctggcttaactgcaggagaagagtatgtcttcagggtagctgca
gttaatgaaaagggaagaagtgatccaagacaacttggagtgccagtaattgcaagggat
attgaaataaagccttcagttgagcttcctttccatactttcaacgtaaaggctagagaa
caacttaagattgatgtgccattcaaaggaagacctcaagctactgtgaactggaaaaaa
gatggtcagactcttaaagagacaactagagtcaatgtttcttcttcaaagactgtaaca
tcactatctattaaggaagcttcaagggaagatgttggaacttatgaattatgtgtttca
aacagtgctggatccataacagttcctcttactataattgtccttgacagaccgggacct
ccaggtcctatacatattgatgaagttagttgtgacaacataaccatttcttggaatcct
ccagaatatgatggtggctgccaaattagcaattacatcgttgaaaagagagaaaccacc
tctacaacatggcacacagtttcacaagcagttgcaagaacatccattaaaatagttcgc
ctgaccacaggaagtgagtatcagttccgtgtttgtgcagaaaaccgctatggaaagagc
tcctacagtgaatcttcagctgttgttgcagagtatccattcagtcccccaggtcctcct
ggtactcctaaagttgtgcatgccacaaaatctaccatgcttgtaacctggcaagtgcca
gttaatgacggaggaagtcgagtaattggctatcatcttgagtataaagaaagaagcagc
attctttggtcaaaagcaaataaaatcctcattgctgatactcaaatgaaagtctccggc
cttgatgaaggactgatgtatgagtatcgtgtatatgctgagaatattgctggaatcggt
aaatgcagtaaatcttgtgaaccagtccctgcaagagatccttgtgaccctcctggacaa
cctgaagtcacaaatatcacaagaaaatcagtgtcacttaaatggtctaaaccacattat
gatggtggagctaaaatcacaggatacattgttgaacgcagagaactaccagatggccgg
tggctgaagtgcaattatactaatatacaggaaacacactttgaagtaactgaacttact
gaagatcagcgttatgaattccgggtttttgcaaagaatgctgctgactcaattagtgag
ccatctgaatccactgggcctattacagttaaagatgatgttgaggctccaagaattatg
atggatgtcaagttccgagatgttattgttgtcaaagctggagaggtccttaagataaat
gcagacattgcagggcgacctctgccagtaatttcctgggccaaggatggtgtagaaatt
gaagaaagagcaagaacagaaataatctcaacagacaatcatactttgttaacagttaaa
gactgtgtaagacgagacactgggcaatatgtactaacactgaagaatgttgccggcact
cggtctgtggccattaattgcaaggtacttgataagcctggtccaccagcaggaccactt
gaaataaatggcctcactgctgagaaatgctctctttcctggggacgcccccaagaagat
ggtggtgcagatatcgactattacatcgtagaaaaacgtgaaacaagccaccttgcatgg
acaatatgtgaaggagagttacggacgacatcctgtaaagtaaccaagttactcaaaggc
aatgaatatatatttagagtaactggtgttaataaatacggtgttggtgagcctctagag
agtgtagctgtaaaggcactagatccatttacagttccaagtccacccacatctttggaa
attacttctgtgacgaaagaatctatgacgctttgctggtcaagacctgagagtgatgga
ggtagtgaaatatctggatatataattgaaagacgagagaaaaatagcctaagatgggtg
cgtgtaaacaaaaaaccagtttatgatctgagagtgaaatcaacaggacttcgggaagga
tgtgaatatgaatatcgtgtttatgcagaaaatgctgctggcctaagtcttccaagtgaa
acctctcccttaattcgagcagaagatccagtgttcctaccatctcctccatctaaaccc
aaaattgtggactcaggcaagacaactataactattgcctgggttaagccactgtttgat
ggtggggccccaataactggatatactgttgaatacaaaaaatctgatgacactgactgg
aaaactgccattcagagcttacgagggacagaatatacaataagtggactaacaacagga
gctgaatatattttcagagtaagatctgtcaataaggttggtgctagtgaccccagtgat
agctccgaccctcagatagcaaaggaaagagaagaagaacctgtatttgatattgacagt
gaaatgaggaagactttgattgtcaaggccggtgcctcatttaccatgactgtgcctttc
cgaggaagaccagtgcccaatgtcttgtggagtaagccagacactgacctccgcactaga
gcttatattgataccacagactctcgtacctcactgaccattgaaaatgccaacagaaat
gactctggaaagtacacattaacaattcagaatgttttgagtgctgcttcactgacctta
gttgtcaaagttttagattccccgggtcctccaaccaacattgctgtgcaagatgtaacc
aaagagtctgcagtgttatcctgggatgttcctgaaaacgatggtggagcaccagtgaag
aattaccacatagaaaaacgtgaggccagcaagaaagcatgggtctctgtgaccaacaac
tgtaaccgcctctcctacaaagttaccaatttacaagaaggagctatctactacttcaga
gtctctggagaaaatgagtttggtgttggtataccagctgaaacaaaggaaggagtaaaa
ataacagaaaaaccaagcccacctgaaaaacttggagtaacaagtacatccaaagacagt
gtttccctgacctggctgaagcctgaacatgatggcggaagcagaattgtacactatgtt
gttgaagcactagaaaaaggacagaaaaactgggttaaatgtgcagtggcaaagtcaacc
catcacgttgtttctggtctgagggagaattctgaatactttttccgggtgtttgctgaa
aatcaagctggcctgagtgacccgagagagcttctgcttcctgttcttattaaggagcaa
ctagaaccacctgaaattgatatgaagaatttcccaagtcacaccgtatatgttagagct
ggttcaaaccttaaagttgacattccaatctctggaaaaccacttcccaaagtgacctta
tcaagagatggtgtccccgtgaaggcaaccatgagatttaataccgaaattactgctgag
aacctgaccatcaatctcaaagaaagtgttacagctgatgctgggagatatgagatcact
gctgccaactccagtggtacagccaaagctttcattaacattgttgtgctggacaggcct
ggtcctccaactggccctgtcgttattagtgatataactgaagaaagtgtgactctcaag
tgggagccacctaagtatgatggtggaagtcaagttaccaactacattctacttaaaaga
gaaaccagtactgcagtatggactgaagtgtctgcaacagttgcaagaaccatgatgaaa
gtcatgaaactgaccacaggagaagaataccaattccgcatcaaggcagaaaaccgcttt
ggcatcagtgatcacatagattcagcttgtgtgactgtcaaactaccatacacaacgcct
ggaccaccatctacaccatgggtcactaatgttactcgagaaagcatcactgtgggctgg
catgaaccagtgtcaaatggaggcagtgcagtcataggctatcacctggaaatgaaagac
agaaacagtattttatggcaaaaagccaacaaactggtcatccgcacaactcacttcaaa
gtcacaacaatcagtgctggacttatttatgaattcagggtgtatgcagaaaatgctgct
ggagttggaaaacccagccatccttctgaaccagtcttggcaattgatgcttgtgaaccc
ccaagaaatgttcgtatcactgatatttcaaagaactctgtcagcctttcgtggcaacaa
ccagcttttgatggaggtagcaagattacaggctacattgttgaaagacgtgaccttcca
gatggcagatggaccaaggccagcttcaccaatgttactgaaactcaattcaccatctct
ggcttgactcagaattcccagtatgaattccgtgtctttgctaggaatgctgttggttcc
attagcaatccatctgaggctgtagggcccattacttgcatcgattcttatggtggtcct
gtaattgatttgcctctagaatatacagaagttgtcaaatacagagcaggtacatctgtg
aggctcagagctggcatttctggcaaacctgcacctacaattgagtggtataaagatgat
aaagaattacaaaccaatgcactggtttgtgtcgaaaacaccacggacctcgcatctata
ctcatcaaagatgccgatcgccttaatagtggatgctatgaattaaaactaaggaatgcc
atgggctcagcctccgccaccatcagagtacagatccttgacaaaccgggcccacctagt
ggaccaattgaatttaagactgtaactgctgaaaagatcaccattctctggcggcctcca
gctgatgatggtggtgcaaaaatcacccactacattgtggaaaagcgtgagacaagccgc
gttgtgtggtctatggtgtctgaacatttggaagagtgcatcattacaaccaccaaaatt
atcaaaggaaatgaatatatcttccgggtccgagccgtcaacaaatatggaattggcgag
ccactggaatctgattccgttgtagccaagaacgcatttgtcacacctgggccaccaggc
ataccagaagtgacaaagattaccaagaattcgatgactgttgtatggagcaggccaatt
gcagatggtggtagtgatgtaagtggctatttccttgaaaaacgagataagaagagtcta
ggatggtttaaagtactaaaagagactatccgtgacaccagacaaaaagtaacaggactc
acagaaaacagtgactatcaatacagagtttgtgctgtaaatgctgctggacagggtcca
ttttctgaaccatctgaattctacaaagctgctgatcctattgatcctccaggtccacct
gctaagataagaattgcagactcaaccaagtcatccatcacccttggctggagtaagcct
gtctatgatgggggcagtgctgttactgggtatgttgttgaaatgagacaaggagaggaa
gaggaatggactattgtctctaccaaaggagaggtcagaactacagaatatgtggtatcc
aacctgaaacctggagtcaattattacttccgggtatctgctgtaaactgtgctggacaa
ggagaacctatagaaatgactgaacctgtacaagctaaagatatacttgaggcaccagag
attgacctggatgtggctctcagaacttctgttattgccaaagctggtgaagatgtacaa
gtgctgattccctttaaaggtagacctccacctactgtcacgtggagaaaagatgagaag
aatattggcagtgatgccagatacagcattgaaaacactgattcatcttcattactcacc
attcctcaagttactcgcaatgatacaggaaaatatattctcacaatagaaaacggagtt
ggtgaacctaagtcttcaactgtgagtgttaaagtgcttgacacaccagctgcctgccag
aaactacaggttaaacatgtttctcgaggcacagtcactttgctctgggatcctcctctc
atcgatggaggatctccaataattaattacgtaattgaaaagagagatgccaccaagaga
acatggtctgtcgtgtcacacaaatgttctagcacatccttcaagctaacagagttgtca
gagaagactccattcttcttcagagttcttgcagaaaatgaaattggaattggggaaccc
tgtgaaactacggagccagtgaaggctgctgaagtaccagctcctatacgtgatctctca
atgaaagactcaacaaagacatctgtcatcctcagctggaccaaacctgactttgatggt
ggtagcgtcatcacagaatatgttgtagaaaggaaaggtaaaggtgaacagacatggtcc
cacgctggcataagtaagacatgtgaaattgaggttagccaacttaaggagcagtcagtc
ttggagttcagagtgtttgccaaaaatgagaaaggactgagtgatcctgtcactattggg
ccaattacagtgaaagaacttattattacgcctgaagttgacctgtcagatatccctggg
gcacaagtcactgtgagaattgggcacaatgtgcaccttgaattaccttataaaggaaag
cccaaaccatccatcagttggctgaaagatggcttgccactgaaagaaagtgaatttgtt
cgtttcagtaaaaccgaaaacaaaattactttgagtattaagaatgccaagaaggagcat
ggaggaaaatacactgttattcttgataatgcagtgtgtagaaatgcagtccccattaca
gtcatcacccttggcccaccatcaaaacccaaaggacccattcgatttgatgaaatcaag
gctgatactgtcatcctgtcatgggatgtacctgaagatgatggaggaggagaaattact
tgttacagcatcgagaagcgggaaacttcacaaactaattggaagatggtgtgttcaagt
gttgccaggacgactttcaaagttcctaatctagtcaaagacgctgagtaccagtttaga
gtgagggcagaaaacagatacggagtcagccaaccacttgtctcaaacattattgtggca
aaacaccagttcaggattcctggtcccccaggaaagccagttatatacaatgtgacttct
gatggcatgtcactaacttgggatgctccagtttatgatggtggttcagaagttactgga
ttccacgttgaaaagaaagaaagaaatagcatcctctggcaaaaagttaatacatcacca
atctctggaagagaatatagagctactggactggtagaaggtctggattaccaattccgt
gtatatgctgaaaattctgctggcctaagctcacctagtgacccaagcaaatttacctta
gctgtttctccagtagacccacctggcactcctgactacattgatgtcacccgggaaacc
atcacacttaaatggaacccaccattgcgtgatggaggcagtaagattgtggcctatagc
attgagaaacggcaaggaaatgaacgctgggtgagatgcaactttactgacgtcagtgaa
tgtcagtatacagttacaggactcagtcctggggatcgctatgagttcagaataattgca
agaaatgctgttggaactataagcccgccctcacagtcttctggcattattatgacaaga
gatgaaaatgttccaccaatagtagagtttggtcctgagtactttgatggtctcattatt
aagtctggagagagccttagaattaaagctctggtacaaggaagaccagtgcctcgagta
acttggttcaaagatggagtggaaatcgaaaagaggatgaatatggaaataaccgatgtc
cttggatccaccagcctatttgttagagatgctactcgggaccatcgtggtatatataca
gtagaagccaaaaatgcatctggttctgcaaaagcagaaattaaagtgaaagtacaagat
acaccaggaaaagtagttgggccaataagattcaccaatattactggggagaagatgact
ctgtggtgggatgctccactcaacgacggttgtgctcccataacccactacatcattgaa
aaacgggaaaccagcagacttgcttgggcactaattgaggataaatgtgaagcccaaagt
tacactgccattaaactaataaacggcaatgaataccaattccgtgtttctgcagttaac
aagtttggtgttggcaggccacttgattctgatccagtggttgctcaaatacaatacact
gttcctgatgcccctggcactccagaacctagcaacgtaacaggcaacagcattaccctg
acatgggcaaggccagaatcagatggtggcagtgaaattcaacagtatatccttgaaaga
agagaaaagaaaagcacaagatgggtaaaagtgatcagtaaacgaccaatctccgaaaca
agattcaaagtcaccggtctgacagaaggcaatgagtatgaattccacgtcatggctgaa
aatgctgcaggagtcggacctgcaagtggcatctcaagactcattaaatgtagagagccc
gtcaacccaccaggtcctcctgcagtggtcaaagtaacagacacatcaaagacaactgtg
agcttagaatggtccaaaccagtgtttgatggcggcatggaaataattgggtacattatt
gaaatgtgcaaggccgacttaggagactggcacaaggtgaatgcagaggcatgcgtgaaa
acaagatatacagtcactgatctacaagcaggtgaagaatacaaattccgagttagtgct
atcaatggtgctggaaaaggagacagctgtgaagtgaccggcacaattaaagcagttgac
cggttaacagctcctgagttagacatagatgcaaacttcaaacagactcatattgttaga
gctggggccagtattcgcctcttcattgcctaccaaggtagacctactcctacagctgtg
tggagcaaaccagactctaaccttagccttcgggctgatatccatacaacagactccttc
agcaccctcactgtggaaaactgcaacagaaatgatgcagggaaatatacccttactgtg
gaaaacaacagtggtagtaagtcgatcacattcaccgtaaaagtgctagacactccaggc
ccgcccggcccaattaccttcaaagatgtgacccggggatcggctacattgatgtgggat
gccccccttcttgatggtggtgcccgaatccatcactatgtggtagagaaacgagaggca
agtcgccgtagttggcaggttatcagtgaaaaatgcactcgacagatcctcaaggtcggt
gacctggcagaaggtgttccatactatttccgtgtttctgcagtaaatgagtatggtgtt
ggtgagccctatgaaatgccagaaccaattgtagccacagaacagcctgctccacctaga
agacttgatgttgttgatactagcaaatcctctgcagtcttagcttggcttaaacctgag
cacgatggaggcagccggatcactggctacctgcttgaaatgagacaaaagggatctgac
ttctgggttgaagctggtcacaccaaacagctgactttcacagtagagcgtcttgttgag
aacaccgaatatgaattccgtgtgaaggccaagaatgatgctggctacagtgaacccagg
gaagccttctcttctgtcatcattaaggagcctcaaatcgagcccactgctgacctcact
ggaattaccaatcagcttataacttgcaaagcaggaagcccatttaccattgacgtacca
atcagtggtcgtcccgcccccaaagtaacatggaaactggaagaaatgagacttaaagag
acggatcgagtgagcattacaacaacaaaagacaggaccaccctgactgtaaaggacagc
atgagaggtgactctggaagatacttcttgaccctggaaaatacagctggtgttaaaaca
tttaccatcacagttgtggtcattggaaggccaggtccagtaaccggccccattgaggtc
tcatctgtctcggctgaatcgtgtgtcctgtcatggggagaacctaaagatgatggaggc
actgaaattactaattacatagttgaaaagcgtgaatcgggtacaacagcttggcatctt
gtcaattccagtgtcaagcgcactcaaattaaagtcactcatctcacaaaatacatggaa
tattctttccgtgtcagttcagagaacagatttggtgtcagcaaacctctagaatcagca
ccaatagttgctgaacatccatttgtcccaccaagtgctcctaccagacctgaggtctat
catgtgtctgccaatgccatgtctattcgttgggaagaaccctaccacgatggtggcagt
aaaatcattggctactgggttgagaagaaagaacgtaacacaattctttgggtgaaagaa
aacaaagtgccatgcttagagtgcaactacaaagtaactggtttagtagaaggactggaa
tatcagttcagaacttatgcactcaatgctgcaggtgttagcaaggccagcgaagcttca
agacctataatggctcaaaatccagttgatgcaccaggcagaccagaggtgacagatgtc
acaagatcaacagtatcactgatttggtctgccccagtgtatgatggaggcagcaaggtt
gtgggctacatcatagagcgtaagccagtcagtgaggtaggagacggtcgctggctgaag
tgcaactataccattgtatctgacaatttcttcaccgtgactgctctcagtgaaggagac
acttatgagttccgtgtgttagccaagaatgcagcaggcgtaattagcaaagggtctgaa
tctacaggccctgtcacttgccgagatgaatacgctccacccaaagccgaactggatgcc
cgattacagggtgatctggttaccatcagagcaggttctgatcttgttctggatgctgca
gttggtggcaaacctgaacccaaaattatctggaccaaaggagacaaggagctagatctc
tgtgaaaaagtctctttgcagtatactggcaaacgagcaactgctgtgatcaagttctgt
gacaggagtgacactggaaaatacactttaacagtgaaaaacgccagcgggaccaaggcc
gtgtctgtcatggtcaaagtgcttgattcccctggcccatgtggaaagctcaccgtcagc
agagtaacagaggagaagtgcactttagcctggagccttcctcaggaagacggaggagca
gaaatcactcactacatcgtggaaagacgcgagactagcaggctcaactgggtgattgtt
gaaggcgaatgcccaaccctatcctatgtcgttaccaggctcatcaagaacaatgagtac
atattccgagtgagggcagtaaacaaatatggccctggtgtgcctgttgaatcagagcca
attgtagccagaaactcattcactattccatcaccacctggcatacctgaagaagttggg
actggcaaagagcatatcatcattcagtggacaaaacctgaatctgatggtggcaatgaa
atcagcaactacctagtagacaaacgtgagaagaagagcctgcgctggacacgtgtcaac
aaagactacgtcgtgtatgataccaggctgaaggtgacgagcctgatggagggttgtgat
taccagttccgagtgactgcagtgaatgcagctggtaacagtgagcccagcgaagcttcc
aacttcatctcatgcagagaaccatcatatacccctggaccaccttctgctccaagagtt
gtggataccaccaaacacagcattagtttggcatggaccaaacccatgtacgatggtggt
gctgacatcacaggatatgttctggaaatgcaagagaaggacactgatcagtggtaccga
gtgcataccaaagccacaataagaaatactgaattcactgtgccagatcttaaaatgggt
cagaaatattccttcagagttgctgccgtgaacgtgaagggtatgagcgaatacagtgaa
tcgattgctgaaattgagcccgtggaaagaatagaaataccagatctcgagcttgcagat
gatctaaagaagactgtgaccatcagggctggggcctccttgcgcttgatggtgtctgta
tctggaagaccacctcctgtcatcacgtggagcaagcagggcattgaccttgcaagtcgg
gcaattattgacaccactgagagctactcattgctaatagtggacaaagttaatcggtat
gatgctggaaaatacacaattgaagctgaaaaccaatctggcaagaaatcagcaacagtc
ctcgttaaagtctatgatactcctggtccctgtccttcagtgaaagttaaggaagtatca
agagattctgtgactataacttgggaaattcccacgattgatggtggagctccagtcaac
aattacattgttgagaagcgtgaagctgccatgagagcattcaaaacagtaactaccaaa
tgcagcaagacactttacagaatttctggacttgtagaaggaaccatgtactacttcaga
gtgctgccagaaaatatttatggcattggagaaccctgtgaaacatctgatgcagtactg
gtctcagaagtgcctttggtgcctacaaagctagaagtggtcgatgtcaccaaatccact
gttacccttgcctgggaaaaaccactctatgatggcggtagccgactcactggatatgtt
ctcgaggcctgcaaagctggcacagagagatggatgaaggttgtcaccttaaaacccaca
gtcctagagcacactgtgacttccttaaatgaaggtgaacaatacttatttagagtgagg
gcacaaaatgagaaaggtgtgtcagaagcaagagagattgtcacagccgtgactgtacaa
gacctcagagtgttgccaacaatcgatctttctacgatgcctcagaagaccatccatgtc
ccagctggcagaccagtagagctggtgatacctattgctggccgtccacctcctgctgct
tcctggttctttgctggttctaaactgagagaatcagagcgtgtcacagttgaaactcac
actaaagtagctaaattaaccatccgtgaaaccactatcagagatactggagaatacaca
cttgaactgaagaatgttactggaactacttcagaaaccattaaagttatcattcttgac
aagcctggtccaccaacaggacctattaggattgatgaaattgatgctacatcaattacc
atttcctgggaaccacctgaattggacggtggtgctccattgagtggttatgtggtagaa
caacgtgatgctcatcgtccaggatggctgcccgtttctgaatcagtgactaggtccacg
tttaagtttaccagactcactgaaggaaatgagtatgtgttccgtgtggctgcaacaaac
cgctttgggattggctcttacttgcagtctgaggtcatagagtgtcgcagcagcatccgt
attcctggacccccagaaacattacagatatttgatgtttcccgtgatggtatgacactt
acttggtacccaccagaggatgacggtggctcccaagtgactggatacattgtggagcgc
aaagaagtgagagcagatcgatgggtccgtgtaaataaagtacctgtgacaatgacacgg
taccgctccactggccttattgaaggcttagaatatgaacaccgtgtcacagccattaat
gcaagagggtctggaaaaccaagtcgtccttccaaacccatcgttgccatggatccaatt
gctcctccaggaaagccacaaaacccaagagttactgatacaacaaggacatcagtttcc
ctggcctggagcgttccagaagatgaaggaggatctaaagtcacaggctacttgattgaa
atgcaaaaagtagatcaacatgaatggaccaagtgtaacaccactccaaccaagattcga
gagtatactctaacacacctacctcagggtgcggaatacaggttccgcatcctagcttgt
aatgctggtggacctggcgagcctgctgaggtaccaggaacagtcaaagtcactgaaatg
cttgaatatcctgattatgaacttgatgaaagataccaggaaggcatctttgtaaggcaa
ggtggagtcatcagacttaccataccaatcaaaggaaaaccattcccaatatgtaaatgg
accaaggaaggccaggatattagtaagcgtgccatgattgcaacatctgaaacacacact
gagcttgtgatcaaagaagcagacaggggtgattctggcacttacgacctggttctggaa
aataaatgtggcaagaaggctgtctacatcaaggtcagggtgataggaagtcccaacagt
ccagaagggccactggaatatgatgacatccaggcccgctctgtgagggtcagctggaga
cctcctgctgatgatggtggtgctgacatcttaggttacatcctcgagagacgagaagtg
cctaaagccgcctggtataccattgattctagagtccgaggtacatctctggtggtaaaa
ggccttaaagagaatgtagaataccatttccgtgtttcagcagaaaaccagtttggcata
agcaagcccttgaaatctgaggaaccagtcataccaaaaacaccactgaatcctccagaa
cctccaagcaatcctccggaagtactcgatgtaaccaagagttctgttagcttgtcctgg
tcccggcccaaagatgatggtggttctcgagtcacaggctactacattgaacgcaaagag
acatccactgacaagtgggtcagacacaacaagactcagatcactaccacaatgtacact
gtcacggggcttgttcccgatgctgagtatcagttccgaatcattgcacagaatgatgtt
ggcctaagtgagaccagccctgcttctgaaccagttgtttgcaaagatccatttgataaa
ccaagccaaccaggagaacttgagattctttcaatatccaaagatagtgtcactctacag
tgggagaaacctgaatgtgatggtggcaaagaaattcttggatattgggttgaatataga
cagtctggagacagtgcctggaagaagagcagtaaggaacgtattaaggacaagcaattc
acaatagggggtttgctggaagctactgaatatgaattcagggtttttgctgagaatgag
actgggctgagcagacctcgaaggactgctatgtctataaagactaaactcacatctgga
gaggccccaggaatacgcaaagaaatgaaggatgttaccaccaaattgggtgaagctgct
caactctcatgccagattgttggaaggcctcttcctgacattaaatggtacagatttggt
aaagagctcatacaaagccggaaatacaaaatgtcttcagatggacgcacacacactctt
acagtaatgacagaggaacaggaagatgaaggtgtttatacctgcatagccaccaatgag
gttggagaagtagaaaccagtagtaagcttctcctgcaagcaacaccacagttccatcct
ggttacccactgaaagagaaatattatggagctgtgggttctacacttcggcttcatgtt
atgtacattggtcgtccagtacctgccatgacttggttccatggtcagaaacttttgcaa
aactcagaaaacattactattgaaaacactgagcactatactcatcttgtcatgaagaac
gtccaacgtaagactcatgctgggaaatacaaagtccagctcagcaatgttttcggaaca
gttgatgccatccttgatgtggaaatacaagataaaccagacaaacctacaggaccaatt
gtgatcgaagctctattgaagaactctgcagtgatcagctggaaaccacccacagatgat
ggaggctcctggatcaccaactatgtggtggaaaaatgtgaggccaaggagggggctgaa
tggcaattggtgtcttcagccatctcagtgacaacctgtagaattgtgaacctcacagaa
aatgccggctattacttccgggtttcagctcagaacactttcggcatcagtgaacctcta
gaagtgtcctcagttgtgatcattaagagtccatttgaaaagccaggtgctcctggcaaa
ccaactattactgctgtcacaaaagattcttgtgttgtggcttggaagccacctgtcagt
gatggaggtgcaaagattagaaattactaccttgagaagcgcgagaagaagcagaataaa
tggatttctgtgacaacagaagaaattcgagaaactgtcttttcggtgaaaaaccttatt
gaaggtcttgaatatgagttccgtgtgaaatgtgaaaacctaggtggggaaagtgaatgg
agtgaaatatcagaacccatcactcccaaatctgatgttccaattcaggcaccacacttt
aaagaggaactgagaaatctaaatgtcagatatcagagcaatgctactttggtctgcaaa
gtgactggtcatccaaaacctatcgtgaaatggtacagacaaggcaaagaaatcattgca
gatggattaaaatataggattcaagaatttaagggtggctatcaccagctcatcattgca
agtgtcacagatgatgatgccacagtttaccaagtcagagctaccaaccaagggggatct
gtgtctggcactgcctccttggaagtggaagttccagctaagatacacttacctaaaact
cttgaaggcatgggagcagttcatgctctccgaggtgaagtggtcagcatcaagattcct
ttcagtggcaaaccagatcctgtgatcacctggcagaaaggacaagatctcattgacaat
aatggccactaccaagttattgtcacaagatccttcacatcacttgttttccccaatggg
gtagagagaaaagatgctggtttctatgtggtctgtgctaaaaacagatttggaattgat
cagaagacagttgaactggatgtggctgatgttcctgacccacccagaggagtcaaagtt
agtgatgtctcacgagattctgtcaacttaacatggactgagccggcctctgatggtggc
agcaaaatcaccaactacattgttgaaaaatgtgcaactactgcagaaagatggcttcgt
gtaggacaagcccgagaaacacgttatactgtgatcaacttatttggaaaaacaagttac
cagttccgggtaatagctgaaaataaatttggtctgagcaagccttctgagccttcagaa
ccaaccataaccaaagaagataagaccagagctatgaactatgatgaagaggtagatgaa
accagggaagtctccatgactaaagcatctcactcttcaaccaaggaactctatgagaaa
tatatgattgctgaagatcttgggcgtggtgagtttggaattgtccaccgttgtgttgaa
acatcctcaaagaagacatacatggccaaatttgttaaagtcaaagggactgatcaggtt
ttggtaaagaaggaaatttccattctgaatattgctaggcatagaaacatcttatacctc
catgaatcatttgaaagcatggaagaattagttatgatctttgagtttatatcaggactt
gacatatttgagcgcattaacacaagtgcttttgaacttaatgaaagagaaattgtaagt
tatgttcaccaggtctgtgaagcacttcagttcttacacagtcataatattggacacttt
gacattagaccagaaaatatcatttaccaaaccagaagaagctctaccattaaaataata
gaatttggtcaagcccgtcagctgaaaccaggggacaacttcaggcttctattcactgcc
ccagaatactatgcacctgaagtccaccagcatgatgttgtcagcacagccacagacatg
tggtcacttggaacactggtatatgtgctattgagtggtatcaacccattcctggctgaa
actaaccaacagatcattgagaatatcatgaatgctgaatatactttcgatgaagaagca
ttcaaagagattagccttgaagccatggattttgttgaccggttgttagtgaaagagaga
aaatctcgcatgacagcatcagaggctctccagcacccatggttgaagcagaagatagaa
agagtcagtactaaagttatcagaacattaaaacaccggcgttattaccacaccctgatc
aagaaagacctcaacatggttgtgtcagcagcccggatctcctgtggtggtgcaattcga
tctcagaagggagtgagtgttgctaaagttaaagtagcatccattgaaattggcccagtt
tctgggcagataatgcatgcagttggtgaagaaggaggacatgtcaaatatgtatgcaaa
attgaaaattatgatcagtctacccaagtgacttggtacttcggtgtccgacagctggag
aacagtgagaaatatgaaatcacctatgaagatggagtggccatcctctatgtcaaagac
attaccaaatttgatgatggtacctaccgatgcaaagtagtcaatgactacggtgaagac
agttcttatgcagagctatttgttaaaggtgtgagagaagtctatgactattactgccgt
agaaccatgaagaaaattaagcgcagaacagatacaatgagactcctggaaaggccacca
gaatttaccctgcctctctataataagacagcttatgtaggtgaaaatgtccggtttgga
gtaactataactgtccacccagagcctcgtgtaacatggtataaatcaggtcagaaaatc
aaaccaggtgacgatgacaagaagtacacatttgagtcagacaagggtctttaccaatta
acaatcaacagtgtcactacagatgatgacgctgaatatactgttgtggcaaggaacaaa
tacggtgaagacagctgtaaagcaaagctgacggtaaccctacacccacctccatcagac
agtaccttaagacccatgttcaaaaggttactggcaaatgcagaatgccaagaaggccaa
agtgtctgctttgagatcagagtgtctggcatccccccaccaacattaaaatgggagaaa
gatggtcagccactgtcccttggacctaacattgaaattatccatgaaggcttggattat
tatgctctgcacatcagggacactttgcctgaagacacaggttattatagagtcacagcc
actaacacagctgggtccaccagctgccaggctcacctacaagtggaacgcctgaggtac
aagaaacaggaattcaagagtagggaggagcatgagcgacacgtacaaaaacaaattgac
aaaaccctcagaatggctgaaattctttctggaactgaaagtgtgccactgacacaggta
gctaaagaggctctgagagaagcttccatcctttacaaaccagctgtaagcaccaagact
gtaaaaggggaattcagacttgagacagaggaaaagaaagaggagagaaaactccggatg
ccttatgatgtaccagagccacgcaagtacaagcagactaccatagaagaagaccaacac
atcaagcagttcgtgcccatgtctgacatgaagtggtataaaaagatacgtgatcagtat
gaaatgcctgggaaacttgacagagttgtacagaaacgacccaagcgcatccgcctttca
agatgggaacagttctatgtgatgcctcttccacgcattacggatcaatacagacctaga
tggcgtattcctaaactgtcccaagatgatcttgagatagtgagaccagcccgccggcgt
acaccttctcctgattattacttttactaccgacctagaagacgttctcttggagacatc
tctgatgaagaattactcctccccattgatgactacttagcaatgaaaagaacagaggaa
gagaggctgcgtcttgaagaagagcttgaattaggtttttcagcttcacccccaagccga
agccctccacgctttgagctttctagcctacgttactcttcaccacaagctcatgtcaag
gtggaggaaacaagaaaagacttcaggtattcaacctatcacatcccaacgaaggctgaa
gctagtacaagttatgcagaactgagggaacggcatgcccaggctgcgtacagacagcca
aagcaacggcaaagaatcatggctgagaaggaggatgaagagttgcttcgcccagttacg
accacccagcgtctctcagaatacaaaagcgaacttgactacatgtcaaaggaggaaaag
tctagaaagaaatcaaggcgacaaagagaagtgacagaaataacagaaattgaggaagaa
tacgaaatctcaaaacgtgctcaaagagaatcatcctcatccgcatctagactactgaga
cgacggcgctccctgtctccaacttatattgagttaatgaggccggtgtctgagctgatc
cggtcacgtccacaaccggctgaggaatacgaagatgacacagaaagaaggtcacctact
ccagaaagaactcgcccacgatcccccagccctgtgtctagtgagagatcactctcgaga
tttgagaggtctgcaagatttgatatcttttccaggtatgagtccatgaaagctgcttta
aaaactcagaagacatcagaaaggaagtatgaagttttgagtcagcagcctttcacactg
gaccatgcccctcgaatcacattgagaatgcgctcacacagggtaccatgtggccaaaat
acacgttttattttaaatgttcagtctaagccaactgctgaggttaaatggtaccacaat
ggtgtggaactccaagaaagcagtaagattcattacaccaacatgagtggagttctgacc
ctggaaattctggactgtcatattgatgacagtggaacctaccgtgctgtgtgcaccaac
tacaagggtgaagcttctgactatgcaacattggacgtaacaggaggggattataccacc
tatgcttccaggcgcagagatgaagaggtccccagatctgttttccctgagctgacaaga
acagaggcgtatgctgtttcatcatttaagaaaacatctgagatggaagcttcgtcttct
gtcagggaagtgaaatcacagatgacagagacaagggaaagtctctcctcatatgaacac
catgcatctgcagaaatgaaaagtgctgcattagaagaaaagtcgctggaagaaaaatcc
acaaccagaaagatcaagacaactttggcggcaagaatgctaacaaagccacggtccatg
actgtccacgagggcgagtctgcaaggttttcttgtgacaccgatggtgagccggtacca
actgtgacctggctgcgtaaaggacaagtgctaagtacttctgcccgccaccaagtgacc
accacaaagtacaaatcaacctttgagatctcttcagttcaggcttccgatgagggcaat
tacagcgtggtggtagaaaacagtgaagggaaacaagaagcagagttcactctgactgtt
caaaaggccagggtaactgaaaaggctgtgacatcaccaccaagagtcaaatccccagag
cctcgggtgaaatccccagaagcagttaaatctccaaaacgagtgaaatctccagaacct
tctcaccccaaagccgtatcacccacagagacaaaaacaacatcaacagagaaagttcag
cacctcccagtctctgccccaccaaagattactcagttcttgaaagcagaagcttctaaa
gagattgcaaagctgacctgtgtggttgaaagcagtgtattaagtgcaaaagaggtcacc
tggtataaagatggcaagaaactgaaggaaaatgggcatttccagtttcattattcagca
gatggtacctatgagctcaaaatccataacctcactgaatctgatcaaggagaatatgtt
tgtgagatttctggtgaaggtggaacatctaaaaccaacttccaatttgtggggcaagcc
tttaagagtatccatgagaaggtatcaaaaatatcagaaactaagaaatcagatcagaaa
accactgagtcaacagaaaccagaaaaactgaaccaaaagctcctgaaccaatttcctca
aaaccagtaattgttactgggttgcatgatacaactgtttcttcagacagtgttgctaaa
tttgcagttaaagctactggagaaccccggccaactgtcatctggacaaaagatggaaag
gctattacacaaggaggtaaatataaactctctgaagacaagggagggttcctcttagaa
attcacaagactgatacttctgacagtggactttatacttgtacggtaaaaaattcagct
ggatctgtgtcctctagctgcaaattaacaataaaagctgtaaaagacactgaggcacag
aaagtctctacacaaaagacttctgaaattacatctcagaagaaagctgttgtccaagag
gaaatttcccaaaaagccctaatgtctgaagaaattaagatgtcagaggcaaaatctcaa
gaaaagttagccctcaaagaggaagcttcaaaggttttgatttccgaagaagtcaagaaa
tcagcagcaacctccctggaaaaatccattgtccatgaggaaatcactaaaacatcacag
gcatcagaagaaatcagaactcatgctgagattaaagcattttctactcagatgagcata
aatgaaggtcaaagagtggttttaaaagccaacattgctggtgccactgatgtgaaatgg
gtactgaatggcatagagcttaccaactctgaggagtaccgatatggtgtctcaggcagc
gatcagaccctcaccatcaagcaagctagtcacagagatgaaggaatcctcacctgcata
ggcaaaaccaaggaaggaatcgtcaagtgtcaatatgatttgatgctgagcaaagaactc
tcagatgctccagccttcatctcccagcctagatctcaaaatattaatgaaggacaaaat
gttctctttacttgtgaaatcagtggcgagccatcccctgaaatcgaatggtttaaaaac
aacctgccaatttctgtttcttcaaatgtcagcataagtcgctccagaaacatatactct
cttgaaatccgaaatgcatcagtcagcgacagtggaaagtacacaattaaggccaaaaat
ttccgtggccagtgttcagctacagcttccttaacggtccttcctctagttgaagaacct
tccagagaggtagtattgagaacaagtggtgacacaagcttgcaaggaagcttctcgtct
cagtcagtccaaatgtctgcctccaagcaggaggcctccttcagcagtttcagcagcagc
agtgctagcagcatgactgagatgaaatttgcaagcatgtctgcccaaagcatgtcctcc
atgcaagagtcctttgtagaaatgagttccagcagctttatgggaaaatctagtatgaca
caactggaaagttcaactagtaaaatgcttaaagcaggcataagaggaattccgcctaaa
attgaagctctgccatctgatatcagcattgatgaaggcaaagttctaacagtagcctgt
gctttcacgggtgagcctaccccagaagtaacatggtcctgtggtggaagaaaaattcac
aatcaagaacaacaggggaggttccacattgaaaacacagatgacctgacaacgctgatc
atcatggacgtacagaaacaagatggtggactttataccctgagtttagggaatgaattt
ggatctgactctgccactgtgaatatacatattcgatccatttaa

DBGET integrated database retrieval system