KEGG   Macaca mulatta (rhesus monkey): 703859Help
Entry
703859            CDS       T01028                                 

Gene name
NOP58
Definition
(RefSeq) nucleolar protein 58
  KO
K14565  nucleolar protein 58
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    703859 (NOP58)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mcc03009]
    703859 (NOP58)
Ribosome biogenesis [BR:mcc03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    703859 (NOP58)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT tRNA-synt_His
Motif
Other DBs
NCBI-GeneID: 703859
NCBI-ProteinID: NP_001248115
Ensembl: ENSMMUG00000000582
UniProt: F6ZQ04
Position
12
AA seq 530 aa AA seqDB search
MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF
TALMEGKINKQLKKVLKKIVKEAHEPLAVADAKLGGVIKEKLNLSCIHSPVVNELMRGIR
SQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELNNYI
MRCREWYGWHFPELGKIISDNLTYCKCLQKVGDRKNYASAKLSELLPEEVEAEVKAAAEI
SMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMAIAPNVTVMVGELVGARLIA
HAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLIYHASLVGQTSPKHKGKISR
MLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDRGIRKISGTGKALAKTEKYE
HKSEVKTYDPSGDSTLPTCSKKRKIEQVDKEDEITEKKAKKAKIKVKVEEEEEEEKVAEE
EETSVKKKKKKGKKKHIKEEPLSEEEPCTSTAIASPEKKKKKKKKRDNED
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttggtgctgtttgaaacgtctgtgggctacgccatctttaaggttctaaatgagaag
aaacttcaagaggttgatagtttatggaaagaatttgaaactccagagaaagcaaacaaa
atagtaaagctaaaacattttgagaaatttcaggatacagcagaagcattagcagcattc
acagctctgatggagggcaaaatcaataagcagctgaagaaagttctgaagaaaatagta
aaagaagcccatgaaccgctggcagtagctgatgctaaactaggaggggtcataaaggaa
aagctgaatctcagttgtatccatagtcctgttgttaatgaacttatgagaggaattcgt
tcacaaatggatggattaatccctggggtagaaccacgtgaaatggcagctatgtgtctt
ggattggctcacagcctgtctcgatatagattgaaatttagcgctgataaagtagacaca
atgattgttcaggcaatttctttgttagatgacttggataaagaactaaacaactacatt
atgcgatgtagagaatggtacggctggcatttccctgaattaggaaaaattatttcagat
aatttgacatactgcaagtgtttacagaaagttggcgataggaagaactatgcctctgcc
aaactttctgagttgctgccggaagaagttgaagcagaagtgaaagcagctgcagagata
tcaatgggaacagaggtttcagaagaagatatttgcaatattctgcatctttgcacccag
gtgattgaaatctctgaatatcgaacccagctctatgaatatctgcaaaatcgaatgatg
gccattgcacccaatgttacagtcatggttggggaattagttggagcacggcttattgct
catgcaggttctcttttgaatttggccaagcatgcagcttctaccgttcagattcttgga
gcagaaaaggcactcttcagagccctcaaatctagacgggatacccctaagtacggtctc
atttatcatgcttcactcgtaggccagacaagtcccaaacacaaaggaaagatttctcga
atgctggcagcgaaaactgttttggctatccgttatgatgcttttggtgaggattcaagt
tctgcaatgggagttgagaacagagccaaattagaggccaggttgagaactttggaagat
agagggataagaaaaataagtggaacaggaaaggcattagcaaaaacagaaaaatatgaa
cacaaaagtgaagtgaagacgtacgatccttctggtgactccacacttccaacctgttct
aaaaaacgcaaaatagaacaggtagataaagaggatgaaattactgaaaagaaagcaaaa
aaagccaagattaaagttaaagttgaagaagaggaagaagaagaaaaagtggcagaagaa
gaagaaacatctgtgaagaagaagaagaaaaagggtaaaaagaaacacattaaggaagaa
ccactttctgaggaagaaccatgtaccagcacagcaattgctagtccagagaaaaagaag
aaaaagaaaaaaaaaagagataacgaggattaa

DBGET integrated database retrieval system