KEGG   Macaca mulatta (rhesus monkey): 704357Help
Entry
704357            CDS       T01028                                 

Gene name
NAT2
Definition
(RefSeq) arylamine N-acetyltransferase 2
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00232  Caffeine metabolism
mcc00983  Drug metabolism - other enzymes
mcc01100  Metabolic pathways
mcc05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    704357 (NAT2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    704357 (NAT2)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    704357 (NAT2)
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     704357 (NAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 704357
NCBI-ProteinID: NP_001038201
Ensembl: ENSMMUG00000021680
UniProt: Q7YRG5 A0A218KU68
Position
8
AA seq 290 aa AA seqDB search
MDIEAYFERIGYKNSRNKLDLETLTDILEHQIRAVPFENLNMHCGEAMELGLETIFDHIV
RRNRGGWCLQVNQLLYWALTTIGFQTTMLGGYVYIPAANKYSTGMIHLLLQVTIDGRNYI
ADAGFGSSSQMWQPLELISGKDQPQMPSIFRLTEQKGIWYLDQIRREQYIPNTEFLNSDL
LPKTTHQKVYSFTLEPRKIEDFESMNTYLQTSPTSAFTTTSFCSLQTPEGIHCLVGFTLT
YRIFNYKDNTDLIEFKTLIEEEVEEVLKNIFKISLGRKLVPKPGNGSFTI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggacattgaagcatattttgaaagaattggctataagaactctaggaacaagctggac
ttggaaacattaactgacattcttgagcaccagatccgagctgttccctttgagaacctt
aacatgcattgtggggaagctatggagttgggcttagagactatttttgatcacattgta
agaagaaaccggggtgggtggtgtctccaggtcaatcaacttctgtactgggctctgacc
acaatcggttttcagaccacaatgttaggagggtatgtttacatccctgcagctaacaaa
tacagcactggcatgattcaccttctcctgcaggtaaccattgatggcaggaactacatt
gctgatgctggctttggaagctcctcccagatgtggcagcctctggaattaatttctggg
aaggatcagcctcagatgccttccattttccgcttgacagaacagaaaggaatctggtac
ctggaccaaatcagaagagagcagtatattccaaacacagaatttcttaattctgatctc
ctgccaaagacgacacaccaaaaagtgtactcttttacgcttgaacctcgaaaaattgaa
gattttgagtctatgaatacatatctgcaaacgtctccaacatctgcatttacaaccaca
tcattttgttccttgcagaccccagaagggattcactgtttggtgggcttcaccctcacc
tatagaatattcaattataaagacaatacagatctgatcgagtttaaaactctgattgag
gaagaagttgaagaagtgctgaaaaatatatttaagatttccttggggagaaagctcgtg
cccaaacctggtaatggatccttcactatttag

DBGET integrated database retrieval system