KEGG   Macaca mulatta (rhesus monkey): 704656Help
Entry
704656            CDS       T01028                                 

Gene name
LAT
Definition
(RefSeq) linker for activation of T-cells family member 1 isoform X2
  KO
K07362  linker for activation of T cells
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    704656 (LAT)
   04015 Rap1 signaling pathway
    704656 (LAT)
   04064 NF-kappa B signaling pathway
    704656 (LAT)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    704656 (LAT)
   04660 T cell receptor signaling pathway
    704656 (LAT)
   04658 Th1 and Th2 cell differentiation
    704656 (LAT)
   04659 Th17 cell differentiation
    704656 (LAT)
   04664 Fc epsilon RI signaling pathway
    704656 (LAT)
   04666 Fc gamma R-mediated phagocytosis
    704656 (LAT)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    704656 (LAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LAT
Motif
Other DBs
NCBI-GeneID: 704656
NCBI-ProteinID: XP_014981335
Position
20
AA seq 235 aa AA seqDB search
MEEAILVPCVLGLLLLPILAVLMALCVHCHRLPGSYDSASSDSLYPRGIQIKRPHTVAPW
PPAYPPVTSYPPLNQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEEPACEDA
DEDEDEDDYHNPGYLVVLPDSTPAASTAAPSATALSTPGLRDSAFSMESIDDYVNVPESG
ESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQKAEEVEEEGAPDYENLQELN
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggccatccttgtcccctgcgtgctggggctcctgctgctgcccatcctggcc
gtgttgatggcactgtgtgtgcactgccacagattgccaggctcctatgacagcgcatcc
tcagatagtttgtatccaaggggcatccagatcaaacggcctcacacagtcgccccctgg
ccacctgcctacccgcctgtcacctcctacccacccctgaaccagccagacctgctcccc
atcccaagatccccgcagccccttgggggctcccaccggacgccatcttccaggcgggat
tccgatggtgccaacagtgtggcgagctacgagaacgaggaaccagcctgtgaggatgcg
gatgaggatgaggatgaggacgactatcacaatccgggctacctggtggtgcttcccgac
agcactccggccgctagcactgccgccccatcagctactgcactcagcacccctggcctc
cgagacagtgccttctccatggagtccattgatgattacgtgaacgttccggagagcggg
gagagcgcagaagcgtctctagatggcagccgggagtatgtgaatgtgtcccaggagctg
catcccggagcggctaagactgagcctgccgccctgagttcccagaaggcggaggaagtg
gaggaagagggggctccagattacgagaatctgcaggagctgaactga

DBGET integrated database retrieval system