KEGG   Macaca mulatta (rhesus monkey): 705450Help
Entry
705450            CDS       T01028                                 

Gene name
CYSLTR2
Definition
(RefSeq) cysteinyl leukotriene receptor 2
  KO
K04323  cysteinyl leukotriene receptor 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    705450 (CYSLTR2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    705450 (CYSLTR2)
G protein-coupled receptors [BR:mcc04030]
 Class A. Rhodopsin family
  Other
   Cysteinyl leukotriene
    705450 (CYSLTR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 TAS2R
Motif
Other DBs
NCBI-GeneID: 705450
NCBI-ProteinID: XP_014976569
Position
17
AA seq 326 aa AA seqDB search
MERKFMSLHPSISVSEMEPNGTFSSNNNSRNCTIENFKREFFPVVYLIIFVWGVLGNGLS
IYVFLQPCKKSTSVNVFMLNLAISDLLFISTLPFRADYYLRGSDWIFGDLACRIMSYSLY
VNMYSSIYFLTVLSVVRFLATVHPFRLLHVTSIRSAWILCGIIWIFTMASSVMLLNNGSE
QKGSVISCLELNLYTITKLQTMNYIALVVGFLLPFFTLSVCYLLIIRALLKVEVPETGLR
VSHKKALTTVIITLIIFFLCFLPYHTLRTLHLVKWKVDICEDRLHKAVVITLALAAANTC
FNPLLYYFAGENFKDRLRSALRKGHP
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaaaatttatgtccttgcatccatccatctccgtatcagaaatggaaccaaat
ggcaccttcagcagtaacaacaacagcagaaactgcacaattgaaaacttcaagagagaa
tttttcccagttgtatatctgataatatttgtctggggagtcttgggaaatggcttgtcc
atatatgttttcctgcagccttgtaagaagtccacatctgtgaatgttttcatgctaaat
ctggccatttcagatctcctgttcataagcacacttcccttcagggctgactattatctt
agaggctccgactggatatttggagacctggcctgcaggattatgtcttattccttgtat
gtcaacatgtacagcagtatttatttcctgaccgtgctgagtgttgtgcgtttcctggca
actgttcacccctttcggcttctgcatgtcaccagcatcaggagtgcctggatcctatgt
gggatcatatggatctttaccatggcttcctcagtaatgctcctcaacaatggctctgag
cagaagggcagtgtcatatcatgcttagagctgaatctctacacaattactaagctgcag
accatgaactatattgccttagtggtgggcttcctgctgccgtttttcacactcagcgtc
tgttatctgctgatcattcgggctctgttaaaagtggaggtcccagaaacggggctgcgg
gtttctcacaagaaggcactgaccaccgtcatcatcaccttgatcatcttcttcttgtgt
ttcttgccctatcacacactgaggacccttcacttggtgaaatggaaagtggatatatgc
gaagacaggctgcataaagctgtggttatcacactggccttggcggcagccaatacatgc
ttcaatcctctgctctattactttgctggggagaattttaaggacagactaaggtctgca
ctccgaaaaggccatccatag

DBGET integrated database retrieval system