KEGG   Macaca mulatta (rhesus monkey): 705915Help
Entry
705915            CDS       T01028                                 

Gene name
ABHD12
Definition
(RefSeq) abhydrolase domain containing 12
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     705915 (ABHD12)
Peptidases [BR:mcc01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   705915 (ABHD12)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   705915 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Peptidase_S9 Thioesterase Peptidase_S15 Abhydrolase_2
Motif
Other DBs
NCBI-GeneID: 705915
NCBI-ProteinID: NP_001248204
Ensembl: ENSMMUG00000009201
UniProt: H9ESJ7
Position
10
AA seq 398 aa AA seqDB search
MRKRTEPVALEHERCAAAGSSSSGSAAAALDADCRLKQNLRLTGTGAAEPRCAADAGMKR
ALGRRKGLWLRLRKILFCVLGLYIAIPFLIKLCPGIQAKLIFLNFVRVPYFIDLKKPQDQ
GLNHTCNYYLQPEEDVTIGVWHTVPAVWWKNAQGKDQMWYEDALASSHAIILYLHGNAGT
RGGDHRVELYKVLSSLGYHVVTFDYRGWGDSVGTPSERGMTYDALHVFDWIKARSGDNPV
YIWGHSLGTGVATNLVRRLCERETPPDALILESPFTNIREEAKSHPFSVIYRYFPGFDWF
FLDPITSSGIKFANDENVKHISCPLLILHAEDDPVVPFQLGRKLYSIAAPARSFRDFKVQ
FVPFHSDLGYRHKYIYKSPELPRILREFLGKSEPEHQH
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagcggaccgagcccgtcgccttggagcatgagcgctgcgccgccgcgggctcg
tcctcctccggctcggctgccgcggcgctggacgccgactgccgcctgaagcagaacctg
cgcctgacgggcacgggggcggccgagccgcgctgcgcagccgacgcgggaatgaaacgg
gcgctgggcaggcgaaagggcctatggttgcgcctgaggaagatactcttctgtgttttg
gggttgtacattgccattccatttctcatcaaactatgtcctggaatacaggccaaactg
attttcttgaatttcgtaagggttccctatttcattgatttgaaaaaaccacaggatcaa
ggtttgaatcacacatgtaactactacctgcagccagaggaagatgtgaccattggagtc
tggcataccgtccccgcagtctggtggaagaacgcccaaggcaaagaccagatgtggtat
gaggatgccttggcttccagccacgctatcattctgtacctgcatgggaacgcaggtacc
agaggaggtgaccaccgcgtggagctttacaaggtgctgagttcccttggttaccatgtg
gtcacctttgactacagaggttggggtgactcggtgggaacgccatctgagcggggcatg
acctatgacgcactccacgtttttgactggatcaaagcaagaagtggtgacaaccctgtg
tacatctggggccactctctgggcactggtgtggcaacaaatctggtgcggcgtctctgt
gagcgagagacgcctccagatgcccttatattggaatctccgttcactaatatccgtgaa
gaagctaagagccatccattttcagtgatatatcgatacttccctgggtttgactggttc
ttccttgatcctattacaagcagtggaattaaatttgcaaatgacgaaaatgtgaagcac
atctcctgtcccctactcatcctgcacgctgaggacgacccggtggtgcccttccagctt
ggcagaaagctctatagcatcgccgcaccagctcgaagcttccgagacttcaaagttcag
tttgtgccctttcattcagaccttggctacaggcacaaatacatttacaagagccctgag
ctgccacggatactgagggaattcctggggaagtcggagcctgagcaccagcactga

DBGET integrated database retrieval system