KEGG   Macaca mulatta (rhesus monkey): 706009Help
Entry
706009            CDS       T01028                                 

Gene name
INSR, IR
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04068  FoxO signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04150  mTOR signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04520  Adherens junction
mcc04910  Insulin signaling pathway
mcc04913  Ovarian steroidogenesis
mcc04923  Regulation of lipolysis in adipocytes
mcc04930  Type II diabetes mellitus
mcc04931  Insulin resistance
mcc04932  Non-alcoholic fatty liver disease (NAFLD)
mcc04960  Aldosterone-regulated sodium reabsorption
Module
mcc_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    706009 (INSR)
   04015 Rap1 signaling pathway
    706009 (INSR)
   04010 MAPK signaling pathway
    706009 (INSR)
   04066 HIF-1 signaling pathway
    706009 (INSR)
   04068 FoxO signaling pathway
    706009 (INSR)
   04072 Phospholipase D signaling pathway
    706009 (INSR)
   04022 cGMP - PKG signaling pathway
    706009 (INSR)
   04151 PI3K-Akt signaling pathway
    706009 (INSR)
   04152 AMPK signaling pathway
    706009 (INSR)
   04150 mTOR signaling pathway
    706009 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    706009 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    706009 (INSR)
   04923 Regulation of lipolysis in adipocyte
    706009 (INSR)
   04913 Ovarian Steroidogenesis
    706009 (INSR)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    706009 (INSR)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    706009 (INSR)
   04213 Longevity regulating pathway - multiple species
    706009 (INSR)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    706009 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    706009 (INSR)
   04931 Insulin resistance
    706009 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    706009 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:mcc04090]
    706009 (INSR)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     706009 (INSR)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   706009 (INSR)
CD molecules [BR:mcc04090]
 Proteins
  706009 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Recep_L_domain fn3 Kinase-like B2 DUF4476
Motif
Other DBs
NCBI-GeneID: 706009
NCBI-ProteinID: XP_014978140
Ensembl: ENSMMUG00000028907
Position
19
AA seq 1096 aa AA seqDB search
MNSSNLLCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGCTVINGSLIINIRGGNNLAAE
LEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETLEIGNYSFYALDNQNLRQLWD
WSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCENELL
KFSYIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVD
IDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDAT
NPSVPLDPTQCLTHIPDYSEVETAFGDPNGKHPPLPGFLGEGSGRHGSSHPFPYVSVYVW
CVCGACVWMCARVCVFSRRDVSPAFLFLSPGLKLPSRTWSPPFESEDSQKHNQSEYEDSA
GECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRKTSSGTGAEDPRPSRKRRSLGD
VGNVTVAVPTVAAFPNTSSTSTPTSPEEHRPFEKVVNKESLVISGLRHFTGYRIELQACN
QDTPEERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNIVHLMWQEPKEPNGLIVLYEV
SYRRYGDEELHLCVSRKHFALERGCRLRGLSPGNYSVRVRATSLAGNGSWTEPTYFYVTD
YLDVPSNIAKIIIGPLIFVFLFSIVIGSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVF
PCSVYVPDEWEVPREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLR
ERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNP
GRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYE
TDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVL
KFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHS
EENKAPENEELEMEFEDMENVPLDRSSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNG
GKKNGRILTLPRSNPS
NT seq 3291 nt NT seq  +upstreamnt  +downstreamnt
atgaattccagcaacttgctgtgcaccccgtgcctgggtccctgtcccaaggtatgccac
ctcctagaaggcgagaagaccatcgactcggtgacgtctgcccaggagctccgaggatgc
accgtcatcaacgggagtctgatcatcaacattcgaggaggcaataatctggcagctgag
ctagaagccaacctcggcctcattgaagaaatttcaggttatctaaaaatccgccgatcc
tacgctctggtgtcactttccttcttccggaagttacgtctgattcgaggagagaccttg
gaaatcgggaactattccttctatgccttggacaaccagaacctaaggcagctctgggac
tggagcaaacacaacctcacgatcactcaggggaaactcttcttccactataaccccaaa
ctctgcttgtcagaaatccacaagatggaagaagtttcaggaaccaaggggcgccaggag
agaaatgacattgccctgaagacaaatggggaccaggcatcctgtgaaaatgagttactt
aaattttcttacattcggacatctttcgataagatcttgctgagatgggagccgtactgg
ccccccgacttccgagacctcctggggttcatgctgttctacaaagaagccccttaccag
aatgtgacggagtttgatgggcaggatgcgtgtggttccaacagctggacggtggtagac
attgacccgcccctgaggtccaacgaccccaaatcacagaaccacccaggatggctaatg
cggggtctcaagccctggacccagtatgccatctttgtgaagaccctggtcaccttttcg
gatgaacgccggacctatggagccaagagtgacatcatttatgtccagacagatgccacc
aacccctccgtgcccctggatccaactcagtgtctaactcatatcccagattattctgaa
gtggaaaccgccttcggggaccccaatggcaaacatccccccctacctggttttctggga
gagggcagcggaagacacggaagcagccatcccttcccgtatgtctcagtgtatgtgtgg
tgtgtgtgtggtgcgtgtgtgtggatgtgtgcgcgtgtgtgtgtgttcagccgcagagac
gtgagcccggcttttctgtttctttctccagggctgaagctgccctcgaggacctggtct
ccaccattcgagtctgaagattctcagaagcacaaccagagtgaatatgaggattcagcc
ggtgaatgttgctcctgtccaaagacagactctcagatcctgaaggagctggaggagtcc
tcgtttaggaagacgtttgaggattacctgcacaacgtggttttcgtccccagaaaaacc
tcttcaggcactggtgccgaggaccctaggccatctcggaaacgcaggtcccttggcgat
gttgggaatgtgacggtggccgtgcccacggtggcagctttccccaacacttcctcgacc
agcacgcccacaagtccggaggagcacaggccctttgagaaggtggtgaacaaggagtcg
ctggtcatctccggcttgcgacacttcacgggctatcgcatcgagctgcaggcttgcaac
caagacacccccgaggaacggtgcagtgtggcagcctacgtcagcgccaggaccatgcct
gaagccaaggctgatgacattgttggccctgtgacgcatgaaatctttgagaacaacatc
gtccacttgatgtggcaggagccgaaggagcccaatggtctgattgtgctgtatgaagtg
agttatcggcgatatggcgatgaggagctgcatctctgtgtctcccgcaagcacttcgct
ctggaacggggctgcaggctgcgcgggctgtcgccggggaactacagcgtgcgagtccgg
gccacctccctcgcgggcaacggctcctggacggaacccacctatttctacgtgacggac
tatttagatgtcccgtcaaatattgcaaaaattatcatcggccccctcatctttgtcttt
ctcttcagtattgtgattggaagtatttatctattcctgagaaagaggcagccagatggg
ccgctgggaccgctttacgcttcttcaaaccctgagtatctcagtgccagtgatgtgttt
ccatgctctgtgtacgtgccggacgagtgggaggtgcctcgagagaagatcaccctcctt
cgagagctggggcagggctccttcggcatggtgtatgagggcaacgccagggacatcatc
aagggtgaggcagagacccgcgtggcagtgaagacggtcaacgagtcagccagtctccga
gagcggattgagttcctcaatgaggcctcggtcatgaagggcttcacctgccatcatgtg
gtgcgcctcctgggagtggtgtccaagggccagcccacgctggtggtgatggaactgatg
gctcacggagacctgaagagctacctccgttctctgcggccagaggctgagaataatcct
ggccgccctccccctaccctgcaagagatgattcagatggcggcggagattgctgacggg
atggcctacctgaatgccaagaagttcgtgcatcgggacctggcagcgagaaactgcatg
gtcgcccatgattttactgtcaaaatcggagactttggaatgaccagagacatatatgaa
acggattactaccggaaaggaggcaagggtctgctccctgtacggtggatggcaccggag
tccctgaaggatggggtctttaccacttcttctgacatgtggtcctttggcgtggtcctt
tgggaaatcaccagcttggcagaacagccttaccaaggcctgtctaatgaacaggtgttg
aaatttgtcatggacggagggtatctggatcaacccgacaactgtccagagagagtcact
gacctcatgcgcatgtgctggcaattcaaccccaagatgaggccaaccttcctggagatc
gtcaacctgctcaaggacgacctgcaccccagctttccggaggtgtcgttctttcacagc
gaggagaacaaggctcccgagaatgaggagctggagatggagtttgaggacatggagaac
gtgcccctggaccgttcctcgcactgtcagagggaggaggcggggggccgggatggaggg
tcctcgctgggtttcaagcggagctacgaggaacacatcccttatacccacatgaacgga
ggcaagaaaaacgggcggattctgaccttgcctcggtccaatccttcctaa

DBGET integrated database retrieval system