KEGG   Macaca mulatta (rhesus monkey): 706532Help
Entry
706532            CDS       T01028                                 

Definition
(RefSeq) 40S ribosomal protein S11-like
Organism
mcc  Macaca mulatta (rhesus monkey)
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_S17_N Ribosomal_S17
Motif
Other DBs
NCBI-GeneID: 706532
NCBI-ProteinID: XP_001099440
Ensembl: ENSMMUG00000044284
UniProt: A0A1D5R6E9
Position
4
AA seq 158 aa AA seqDB search
MADVQTEHAYQKQLTIFQNKKRVLLGETGKEKLPRYYKNIGLGFKTPKEATEGTYIDKKC
PFTGNVSIQGRILSGVVTKMKMQGTIVIRRDYLHYIRKYNRFENRHKNMSVHLSPCFRDV
QIGDIVTVGECWPLSKTVCFNVLKVTKAAGTKKQFQKF
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgttcagactgagcatgcctaccaaaagcagctgaccatctttcaaaacaag
aagagggtcctgctgggagaaactggcaaggagaagctcccgcggtactacaagaacatc
ggtctgggcttcaagacacccaaagaggctactgagggcacttacattgacaagaaatgc
cccttcactggtaatgtctccattcaagggcggatcctctctggtgtggtgaccaagatg
aagatgcaggggaccattgtcatccgccgagactacctccactacatccgcaagtacaac
cgcttcgagaatcgccacaagaacatgtctgtgcacctgtccccctgcttcagggacgtc
cagatcggtgacatcgtcacagtgggcgagtgttggcccctgagcaagacagtgtgcttc
aacgtgctcaaggtcaccaaggctgctggcaccaagaagcagttccagaagttctga

DBGET integrated database retrieval system