KEGG   Macaca mulatta (rhesus monkey): 706732Help
Entry
706732            CDS       T01028                                 

Gene name
GPX1
Definition
(RefSeq) glutathione peroxidase 1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00480  Glutathione metabolism
mcc00590  Arachidonic acid metabolism
mcc01100  Metabolic pathways
mcc04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    706732 (GPX1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    706732 (GPX1)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    706732 (GPX1)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     706732 (GPX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 706732
NCBI-ProteinID: NP_001152770
Position
2
AA seq 198 aa AA seqDB search
MCAARLAAAAVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDYTQMNELQRR
LGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPL
FAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPVRRYSRRFQT
IDIEPDIEALLSQGPSSA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgctgctcggctagcggcggcagcggtgtacgccttctcggcgcgcccgctggcc
ggcggggagcctgtgagcctgggctccctaaggggcaaggtgctacttatcgagaatgtg
gcgtccctctgaggcaccacggtccgggactacacccagatgaacgagctgcagcggcgc
cttgggccccggggcctggtggtgctcggcttcccgtgcaaccagtttgggcatcaggag
aacgccaagaacgaagagattctgaattccctcaagtacgtccgacctggtggtgggttc
gagcccaacttcatgctcttcgagaagtgcgaggtgaacggtgcaggggcgcaccctctc
ttcgccttcctgcgggaggccctgccagcccccagcgacgatgccactgcgctcatgacc
gaccccaagctcatcacctggtctccggtgtgccgcaacgatgttgcctggaacttcgag
aagttcctggtgggccctgacggtgtgcccgtacgcaggtacagccgccgcttccagacc
attgacatcgagcctgacatcgaagccctgctgtctcaaggtcccagcagtgcctag

DBGET integrated database retrieval system