KEGG   Macaca mulatta (rhesus monkey): 706852Help
Entry
706852            CDS       T01028                                 

Gene name
METTL3
Definition
(RefSeq) N6-adenosine-methyltransferase catalytic subunit
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mcc03019]
    706852 (METTL3)
Enzymes [BR:mcc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     706852 (METTL3)
Messenger RNA biogenesis [BR:mcc03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     706852 (METTL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70 DUF445 DUF5521
Motif
Other DBs
NCBI-GeneID: 706852
NCBI-ProteinID: XP_014998741
Ensembl: ENSMMUG00000014997
UniProt: G7MWT2
Position
7
AA seq 580 aa AA seqDB search
MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLRNPEAALSPTFRSDSPVPTAPTSGG
PKPSTASAVPELATDPELEKKLLHHLSDLALTLPTDAVSICLAISTPDAPATQDGVESLL
QKFAAQELIEVKRGLLQDDAHPTLVTYADHSKLSAMMGAVAEKKGPGEVAGTVTGQKRRA
EQDSTTVAAFASSLASGLSSSASEPAKEPAKKSRKHAASDVDLEIESLLNQQSTKEQQSK
KVSQEILELLNTTTAKEQSIVEKFRSRGRAQVQEFCDYGTKEECMKASDADRPCRKLHFR
RIINKHTDESLGDCSFLNTCFHMDTCKYVHYEIDACMDSEAPGSKDHTPSQELALTQSVG
GDSSADRLFPPQWICCDIRYLDVSILGKFAVVMADPPWDIHMELPYGTLTDDEMRRLNIP
VLQDDGFLFLWVTGRAMELGRECLNLWGYERVDEIIWVKTNQLQRIIRTGRTGHWLNHGK
EHCLVGVKGNPQGFNQGLDCDVIVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNV
QPNWITLGNQLDGIHLLDPDVVARFKQRYPDGIISKPKNL
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacacgtggagctctatccaggcccacaagaagcagctggactctctgcgggag
aggctgcagcggaggcggaagcaggactcggggcatttggatctacggaatccagaggca
gcattgtctccaaccttccgtagtgacagcccagtgcctactgcacccacctctggtggc
cctaagcccagcacagcttcagcagttcctgaattagctacagatcctgagttagagaag
aagttgctacaccacctctctgatctggccttaacattgcccactgatgctgtgtccatc
tgtcttgccatctccacgccagatgctcctgccactcaagatggggtagaaagcctcctg
cagaagtttgcagctcaggagttgattgaggtaaagcgaggtctcctacaagacgatgca
catcctactcttgtgacctatgctgaccattccaagctctctgccatgatgggtgctgtg
gcagaaaagaagggccctggggaggtagcagggactgtcacagggcagaagcggcgtgca
gaacaggactcaactacagtagctgcctttgccagttcattagcctctggtctgagctct
tcagcatcagaaccagcaaaggagccagccaagaaatcaaggaaacatgctgcctcagat
gttgatctggagatagagagccttctgaaccaacagtccaccaaggaacaacagagcaag
aaggtcagtcaggagatcctagagctattaaatactacaacagccaaggaacaatccatt
gttgaaaaatttcgctctcgaggtcgggcccaagtgcaagaattctgtgactatggaacc
aaggaggagtgcatgaaagccagtgatgctgatcgaccctgtcgcaagctgcacttcaga
cgaattatcaataaacacactgatgagtctttaggtgactgctctttccttaatacatgt
ttccacatggatacctgcaagtatgttcactatgaaattgatgcttgcatggattctgag
gcccctggcagcaaagaccacacgccaagccaggagcttgctcttacacagagtgtcgga
ggtgattccagtgcagaccgactcttcccacctcagtggatctgttgtgatatccgctac
ctggacgtcagtatattgggcaagtttgcagttgtgatggctgacccaccctgggatatt
cacatggagctgccctatgggaccctgacagatgatgagatgcgcaggctcaacataccc
gtactacaggatgatggctttctcttcctctgggtcacaggcagggccatggagttgggg
agagaatgtctaaacctctgggggtatgaacgggtagatgaaattatttgggtgaagaca
aatcaactgcaacgcatcattcggacaggccgtacaggtcactggttgaaccatgggaag
gaacactgcttggttggtgtcaaaggaaatccccaaggcttcaaccagggtctggattgt
gatgtgatcgtagctgaggttcgttccaccagtcataaacccgatgaaatctatggcatg
attgaaagactatctcccggcactcgcaagattgagttatttggacgaccacacaatgtg
caacccaactggatcacccttggaaaccaactggatgggatccacctgctagacccagat
gtggttgcacggttcaagcaaaggtacccagatggtatcatctctaaacctaagaattta
tag

DBGET integrated database retrieval system