KEGG   Macaca mulatta (rhesus monkey): 707162
Entry
707162            CDS       T01028                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    707162 (AKAP5)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     707162 (AKAP5)
SSDB
Motif
Pfam: WSK NINJA_B
Other DBs
NCBI-GeneID: 707162
NCBI-ProteinID: XP_001102077
Ensembl: ENSMMUG00000042066
UniProt: A0A1D5QW76
Position
7
AA seq 427 aa
METTVSEIHVENKDEKRSAEGSPGAERQKEKASMLCFKRRKKAAKALKPKVGSEAADVAR
KCPQEAGASDQPEPPRGAWASLKRLVTRRKRSESSKQQKLLEAEVQPAINTEDADLSKKK
AKSRLKIPCIKFPRGPKRSNHSKIIEDSDCSIKVQEEAEILDIQTQTPLNDQATKAKSTQ
DLSEGISRKDGDEVCESNVSNSITSGEKVISVELGLDDGHSAIQTGTLILEEIETVKEKQ
DVQPQQAGPLETSETDHQQIVLSDVPPLPAIPAQQIMEEASNNILKSAPNGKDYESREIV
AEETKPKDTELSQESDFKENGITEEKSTLEESKRIEPIAIIITDTEISEFDVKKSKNVPK
QFLISTENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSVEQLVNEMASDDN
KINNLLQ
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggaaaccacagtttcagaaattcatgtagaaaacaaggatgagaagagatcagcagaa
ggtagtcctggggctgaaagacagaaggaaaaggcatccatgctttgcttcaagagaaga
aagaaagcagctaaagcactgaagcccaaagttggctctgaagctgctgatgtggcaagg
aagtgtccccaagaagcaggagcttctgatcagccagagcccccacggggggcctgggcc
tcactcaaacgtcttgtaacacgcaggaaaaggtcagagtcttcaaagcagcaaaagtta
ttggaggctgaagtgcaacctgcaataaacactgaggatgctgatctttctaagaaaaag
gcaaaatctagacttaagattccctgcataaaattcccaagagggccaaaaaggagtaat
cattccaaaattatagaagactcagactgcagcatcaaagtccaggaagaagctgaaatt
ttggatatacaaacacagaccccattgaatgatcaggcaacaaaggctaagtcaacccag
gatctaagtgaaggcatctcacggaaagatggtgatgaagtctgtgaatcaaatgtgagc
aatagcataacttctggagagaaagtgatttcagtagaacttggattagatgatgggcat
tctgctattcaaacgggaactctaatccttgaagaaattgaaacggtcaaggaaaaacaa
gatgttcaaccccagcaagcaggcccacttgaaacttcagaaacagaccatcagcaaata
gtactttctgatgttccacctttacctgcaatcccagctcaacaaattatggaagaagcc
agtaacaatatcctaaaaagtgcaccaaatgggaaagactatgaaagtagagagattgta
gctgaagaaactaagccaaaagatactgaattgagccaagaatcagattttaaagaaaat
gggatcactgaagagaagtccacattagaagaaagcaaacgaatagagcccattgctatt
attattacagacactgaaatcagtgaatttgatgttaagaaatcaaaaaatgtccctaag
caattcttaatttcaactgaaaatgagcaagtaggggtttttgctaatgataatggtttt
gaggatagaacttcagaacaatatgaaacactcttaattgaaacagcctcttctcttgtc
aagaatgctattcagttgtcagtagaacagctggttaatgaaatggcctctgatgataat
aaaataaacaatcttctacagtga

DBGET integrated database retrieval system