KEGG   Macaca mulatta (rhesus monkey): 707386
Entry
707386            CDS       T01028                                 

Gene name
CFP
Definition
(RefSeq) properdin
  KO
K15412  complement factor properdin
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    707386 (CFP)
SSDB
Motif
Pfam: TSP_1 TSR TSP1_spondin TSP1_ADAMTS
Other DBs
NCBI-GeneID: 707386
NCBI-ProteinID: XP_014982784
Ensembl: ENSMMUG00000032465
UniProt: F7CGG5
Position
X
AA seq 469 aa
MITEGAQAPCLLLPPLLLLLTLPATGSDPVLCFTQYEESSGKCKGLLGGGVSVKDCCLNT
AYAYQERNGGLCQPCRSPRWSLWSTWAPCSVTCSEGSQLRYRRCVGWNGQCSEKVALGTL
EWQLQACEDKQCCPEMGGWSDWGPWEPCSVTCSKGMRTRRRACDHPAPKCGGHCPGEAQE
SEACDTQQVCPTHGAWAAWGPWSPCSGSCHGGPHEPKETRSRTCSAPEPSQKPPGKPCPG
PAYEHRKCTGLPPCPVAGGWGPWGPVSPCPVTCGLGQTIERRTCNRPVPQHGGPSCAGDA
TRTHICNTAVPCPVDGEWDLWGQWSTCVRRNMKSISCEEIPGQQSRWRTCKGRKFDGHRC
TGQQQDIRHCYSIQHCPLKGSWSEWSTWGLCMPPCGPNPTRARQRLCTPLLPKYPPTVSM
VEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEKL
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgatcacagagggagcgcaggccccttgcttgctgctgccgccgctgctgctgctgctc
accctgccagccacaggctcagaccccgtgctctgcttcacccagtatgaagaatcctcc
ggcaagtgcaagggcctcctggggggtggtgtcagcgtgaaagactgctgtctcaacact
gcctatgcctaccaggaacgtaatggcgggctctgtcagccttgcaggtccccacgatgg
tccctgtggtccacatgggccccctgttcggtgacatgctctgagggctcccagctgcgg
taccggcgctgtgtgggctggaatgggcagtgctctgagaaggtggcacttgggaccctg
gagtggcagctccaggcctgtgaggacaagcagtgctgtcctgagatgggcggctggtct
gactgggggccctgggagccttgctccgtcacctgctccaaagggatgcggacccgcaga
cgagcctgtgatcaccctgcccccaagtgtggaggccactgcccgggagaggcacaggaa
tcagaggcctgtgacacccagcaggtctgccccacacacggggcctgggccgcctggggt
ccctggagcccctgctcaggatcctgccacggtggaccccacgaacctaaggagacacga
agccgcacgtgttctgcacctgagccttcccagaagcctcctgggaagccctgcccaggg
ccagcctatgagcatcggaagtgcaccggcctgccgccttgcccagtggctgggggctgg
gggccttggggccctgtgagcccctgccctgtgacctgtggcctgggccagaccatagaa
cgacggacgtgcaatcgccctgtgccccagcatggaggcccctcctgtgctggtgatgcc
acccggacccacatctgcaacacagccgtgccctgccctgtggatggagagtgggacttg
tggggacagtggagcacctgtgtccgccggaacatgaagtccatcagctgtgaagaaatc
ccgggccagcagtcacgctggaggacctgcaagggccgcaagtttgacggacatcgatgt
accgggcaacaacaggatattcggcactgctacagcatccaacactgccccttgaaagga
tcatggtcagagtggagtacctgggggctgtgcatgcccccctgtggacctaatcctacc
cgtgcccgccagcgcctctgcacacccttgctccccaagtacccgcccaccgtttccatg
gtcgaaggtcagggcgagaagaacgtgaccttctgggggagaccgctgccacggtgtgag
gagctacaggggcagaagctggtggtggaggagaaacgaccatgtctacacgtgcctgct
tgcaaagaccctgaggaagagaaactctaa

DBGET integrated database retrieval system