KEGG   Macaca mulatta (rhesus monkey): 707690Help
Entry
707690            CDS       T01028                                 

Gene name
PLA2G4F
Definition
(RefSeq) cytosolic phospholipase A2 zeta isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00564  Glycerophospholipid metabolism
mcc00565  Ether lipid metabolism
mcc00590  Arachidonic acid metabolism
mcc00591  Linoleic acid metabolism
mcc00592  alpha-Linolenic acid metabolism
mcc01100  Metabolic pathways
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04217  Necroptosis
mcc04270  Vascular smooth muscle contraction
mcc04370  VEGF signaling pathway
mcc04611  Platelet activation
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04724  Glutamatergic synapse
mcc04726  Serotonergic synapse
mcc04730  Long-term depression
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04912  GnRH signaling pathway
mcc04913  Ovarian steroidogenesis
mcc04921  Oxytocin signaling pathway
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    707690 (PLA2G4F)
   00565 Ether lipid metabolism
    707690 (PLA2G4F)
   00590 Arachidonic acid metabolism
    707690 (PLA2G4F)
   00591 Linoleic acid metabolism
    707690 (PLA2G4F)
   00592 alpha-Linolenic acid metabolism
    707690 (PLA2G4F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    707690 (PLA2G4F)
   04010 MAPK signaling pathway
    707690 (PLA2G4F)
   04370 VEGF signaling pathway
    707690 (PLA2G4F)
   04072 Phospholipase D signaling pathway
    707690 (PLA2G4F)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    707690 (PLA2G4F)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    707690 (PLA2G4F)
   04664 Fc epsilon RI signaling pathway
    707690 (PLA2G4F)
   04666 Fc gamma R-mediated phagocytosis
    707690 (PLA2G4F)
  09152 Endocrine system
   04912 GnRH signaling pathway
    707690 (PLA2G4F)
   04913 Ovarian steroidogenesis
    707690 (PLA2G4F)
   04921 Oxytocin signaling pathway
    707690 (PLA2G4F)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    707690 (PLA2G4F)
  09156 Nervous system
   04724 Glutamatergic synapse
    707690 (PLA2G4F)
   04726 Serotonergic synapse
    707690 (PLA2G4F)
   04730 Long-term depression
    707690 (PLA2G4F)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    707690 (PLA2G4F)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    707690 (PLA2G4F)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     707690 (PLA2G4F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 707690
NCBI-ProteinID: XP_014997507
Ensembl: ENSMMUG00000015449
UniProt: F6VHL0
Position
7
AA seq 849 aa AA seqDB search
MLWALWPRWLAGKMLPFLGAVLLQKRENRGPLRRHWRRETHPYYDLQVKVLRATNIRNTD
LLSKADCYVQLWLPTASPSPAQTRTVANCSDPEWNETFHYQIHDAVKNVLELTLYDKDIL
VSDQYSQLLFDLRSLECGQPHRHSFPLNRQDSQELQVEFVLEKSQVPASEIITNGVLVAH
PCLRIQGTLRGDGTAPREEYGSRQLQLTVPGAYEKPQLLPLQPPTEPGLQPTFTFHVNPV
LSSRLHVELMEQLSAVQSDPSAELEAQTSKLGEGGILLSSLPLGQEKQCSVALGEGQEVA
LSVKVEMSSGDLDLRLGFDLCDGEQEFLDRRKQVVAKALQQVLGLSEAPDSGQVPVVAVL
GSGGGTRAMSSLYGSLAGLQELGLLDTVTYLSGVSGSTWCISTLYRDPAWSQVALQGPIE
RAQVHVCSSKMGALSTERLQYYAQELGVRKRSGHSVSPVDLWGLFVEYFLYQEENPAKLS
DQQEAVRQGQNPYPIYTSINVCSDMSGEDFAEWCEFTPYEVGLPKYGAYVPTELFGSELF
MGRLLQLQPEPRICYLQGVWGSAFATSLEEISLKTVGSGLSFLEWYRGSVNITDDCQKPQ
PHNPSTLPTRILTPQGPFSQAVLGIFTSRFTSAQIFNFTRGLCLHKDYVADREFVAWKDR
HPDASPNHLTPMRDCLYLVDGGFAINSPFPLALRPQRAVDLILSFDYSLEAPFEVLKMTE
KYCLDRGIPFPSIEVGPEDMEEARECYLFAKAEDPRSPVVLHFPLVNRTFRTHLAPGVER
QTAEEKAFGDFVINRPDTPYGMMNFTYEPQDFDRLVALSRYNILNNVETLKCALQLALDR
HQARERAGD
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atgctctgggcactctggccaaggtggctggcaggcaagatgctgcccttcctgggggca
gtgctgcttcagaagagagagaacaggggccctctgcggaggcactggcggcgggaaacc
cacccatactatgacctccaggtgaaggtgctgagggccacaaacatccggaatacagac
ctgctgtccaaagctgactgctacgtgcaactgtggctgcccacggcgtcccccagccct
gcccagactaggacagtggccaactgcagtgaccccgagtggaatgagactttccactac
cagatccatgatgctgtgaagaatgttctggagctcactctgtatgacaaggacatcctg
gtcagcgaccagtattcccagctcctgtttgacctgaggagcctcgagtgcggccaacct
cacagacacagcttcccactcaaccgccaggattcacaagagctgcaggtggaatttgtt
ctggagaagagccaggtgcctgcatctgaaatcatcaccaacggggttctggtggctcac
ccctgtctgagaatccagggcacactccggggagatgggaccgccccacgggaagagtac
ggctctcggcagctccagctgacagtgcctggggcctacgagaagccacagctcttgccc
ctgcagcctcccacagagccaggcctccaacccacctttaccttccatgtgaacccagtg
ctgagctccaggctacacgtggagctgatggagcagctctcggctgtgcagagcgacccc
agcgcggagctggaggctcagaccagcaagctgggcgaggggggcatcctgctctcctct
ctgcccctaggccaggagaaacagtgttctgtggccctgggggagggccaggaggtggct
ctgagtgtgaaggtggaaatgagctccggagacctagacctacgccttggctttgacctc
tgtgacggggagcaggagtttctggacaggaggaagcaggtcgtggccaaggccctgcag
caggtgctgggattgagtgaggctccggacagtggccaggttcctgtagtggctgtgttg
ggttccgggggtggaacccgagccatgtcctctctgtacggcagcctggcagggttgcag
gagctcggcctgctagacactgtgacctacctgagtggggtctctgggtccacctggtgc
atctccacactctacagggacccagcctggtcccaggtggccttgcagggccccattgag
cgtgcccaggttcacgtctgcagcagtaagatgggagctttgtccacggagcggctacag
tactacgctcaggaactgggggtccggaagcgcagtggccacagcgtgtccccggtcgac
ctctggggcctctttgtggagtatttcctgtaccaggaggagaaccctgccaagctgtct
gaccaacaggaggcggtccgccagggtcagaacccttaccccatttacaccagtatcaac
gtctgctccgacatgagtggggaagattttgcagagtggtgcgagttcacgccctacgag
gttggcttgcccaagtacggggcttatgttcccaccgagctctttggctcagagcttttc
atgggacgattgctgcagctccagcccgagccccggatctgctacctgcaaggtgtgtgg
ggcagtgcctttgccaccagcctggaagagatctccctaaagactgtgggctcgggcctc
agcttcctggagtggtacagaggcagtgtgaatatcacagatgactgccagaagcctcag
ccacacaacccatcgacgctgccaacaaggatccttaccccacaggggcccttctcccag
gctgtgctgggcatattcacctcccgcttcacttctgcccagatttttaacttcacccgg
ggtctctgcttgcacaaggactatgtggctgacagagagtttgtggcctggaaagacaga
cacccagacgcctcccccaaccatctcacccccatgcgggactgcctgtacctggtggac
ggaggcttcgccatcaactctccgttcccactggctctgcggcctcagagagccgtggac
ctcattctgtccttcgactattccttggaagctccttttgaggtcttgaagatgacagag
aagtactgcctggaccgaggaatccccttccctagcatcgaggtgggccctgaagacatg
gaggaggcccgtgagtgctatctgtttgccaaggctgaggacccccgctcccccgtcgtg
ctgcacttcccccttgtcaaccgtaccttccgcacacacctggccccaggtgtggagcga
caaacagctgaggagaaggcctttggggactttgtcatcaacaggccagacaccccctat
ggcatgatgaacttcacctatgagccccaggactttgatcggctggtggccctgagtcga
tacaatattctgaacaatgtggagaccttgaagtgtgccctccagctggctctggaccgg
caccaggctcgggagagggctggggactga

DBGET integrated database retrieval system