KEGG   Macaca mulatta (rhesus monkey): 708037Help
Entry
708037            CDS       T01028                                 

Gene name
MTMR8
Definition
(RefSeq) myotubularin-related protein 8 isoform X1
  KO
K18083  myotubularin-related protein 6/7/8 [EC:3.1.3.64 3.1.3.95]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00562  Inositol phosphate metabolism
mcc01100  Metabolic pathways
mcc04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    708037 (MTMR8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    708037 (MTMR8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    708037 (MTMR8)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     708037 (MTMR8)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     708037 (MTMR8)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    708037 (MTMR8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related Vps36_ESCRT-II Y_phosphatase DSPc
Motif
Other DBs
NCBI-GeneID: 708037
NCBI-ProteinID: XP_001097351
Ensembl: ENSMMUG00000004274
UniProt: F6ZSQ9
Position
X
AA seq 710 aa AA seqDB search
MDHITVPKVENVKLVDRYVSKKPANGILYLTATHLIYVEASGAARKETWIALHHIATVEK
LPITSLGCPLTLRCKNFRVAHFVLDSDLVCHEVYISLLKLSQPALPEDLYAFSYNPKSSK
EMRESGWKLIEAISDFGRMGIPNRYWTITDANRNYEICSTYPPEIVVPKSVTLGTVVGSS
KFRSKERVPVLSYLYKENNAAICRCSQPLSGFYTRCVDDELLLEAISQTNPGSQFMYVVD
TRPKLNAMANRAAGKGYENEDNYANIRFRFMGIENIHVMRNSLQKLLEVCELKTPTMSEF
LSGLESSGWLRHIKAIMDAGIFITKAVKVEKASVLVHCSDGWDRTAQVCSVASILLDPFY
RTFKGLMILIEKEWISMGHKFSQRCGHLDGDSKEVSPIFTQFLDCIWQLMEQFPCAFEFN
ENFLLEIHDHVFSCQFGNFLGNCQKDREDLRVYEKTHSVWPFLVQRKPDFRNPLYKGFTM
YGVLNPSTVPYNIKFWCGMYNRFDKGLQAKQSILENLLEIKKQRAMLETDVHELEKKLKA
RDEPPEEICTCTQLGNLLSQHLGSPLTNPLGFMGIDGDLNTLMENGTLSREGGLRAQMDQ
VKSQCADLHHNHCEIVSSLRAINISGDVGISGGTGISEAMGISGDMSTFETMGFSEDLGI
CGAMDISEATDISGNMGISEARGFSGDMGILGDTGISKASTKEADYSKHQ
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atggatcatattacggtacccaaggtagaaaatgtgaaattggtggatcgttatgtgagt
aagaaaccagctaatgggattctttatcttactgcaacccacctgatctatgtggaggct
tctggtgcagcccggaaagaaacatggattgcactccatcacattgccaccgtggagaag
ttacccatcactagcctgggctgtcccctgaccctccgctgcaagaatttccgggtggcc
cactttgttttagactctgaccttgtgtgccatgaggtttatatttcactgctcaagctt
tctcagccagcattacctgaagacctttatgctttttcttataatcccaaatcctcaaaa
gagatgagggaaagtggatggaaactgattgaagcaatatcagactttgggcgtatggga
atacccaacagatactggaccataacagatgccaacagaaactatgagatatgcagcacc
taccctcctgaaatagtggttcctaaatctgttaccttgggaacggtggttggaagttca
aagttcagaagtaaagaacgtgtccctgtgctctcctacctctacaaagagaacaatgct
gccatttgccgctgtagccagcctctctctggattttatactcgctgtgtagatgatgag
ctcttgttggaggccattagccaaacaaacccagggagccagtttatgtatgttgtagac
acaagaccaaagttgaatgccatggccaaccgagcagctgggaagggatatgaaaatgaa
gacaactatgccaacattcgcttcagattcatgggcattgagaacatccatgtaatgcgg
aacagtctgcagaaactcttggaagtttgtgaattgaaaactccaacaatgagtgaattt
cttagcggcctggagagctcagggtggttaagacacattaaagctattatggatgctgga
attttcattacaaaggcagtgaaggtagaaaaggccagtgtcttagtccattgttctgat
gggtgggaccgcacagcacaagtctgctcggtggctagcatcctcctagatccattttat
aggacattcaaaggactcatgatcttgatagagaaggaatggatatccatgggccacaag
ttttcccaaaggtgtggccacctcgatggggactctaaagaagtgtcccctatcttcacc
cagttcctagactgtatctggcaattaatggaacagtttccctgtgcctttgagtttaat
gaaaacttcctgctagagattcatgaccatgttttctcctgccagtttggaaacttcctt
ggtaactgccagaaggatcgggaagatctaagagtctatgagaaaacacattctgtgtgg
cctttcttggttcagaggaaaccagacttcaggaaccctctctataaaggcttcactatg
tatggggtactcaatcctagtactgtgccctacaacattaagttctggtgtgggatgtat
aaccgctttgacaaagggctgcaggccaagcagagtatactagagaacctcctggaaatt
aagaaacagagagcaatgctggagacagatgtgcatgaactagaaaagaaactaaaagcc
cgtgatgagccaccagaagagatctgtacctgcactcaattaggaaacttattatcccag
catctgggaagtcctttgaccaatcctcttggcttcatgggtatcgatggagacctgaat
accttgatggagaatggcaccctctccagggaaggaggcctccgagctcagatggatcaa
gtaaaaagccagtgtgcagacctccaccataaccattgtgagattgtgagcagccttagg
gccataaatatctctggggatgtgggcatctctggagggacaggcatctctgaggccatg
ggcatctctggagacatgagcacctttgagactatgggcttctccgaagacttaggaatc
tgtggggccatggatatctctgaggccactgacatatctggaaacatgggtatttctgag
gccaggggtttctctggggacatgggcatcttgggggacacaggcatctccaaggccagc
accaaggaggcagactactccaagcatcagtga

DBGET integrated database retrieval system