KEGG   Macaca mulatta (rhesus monkey): 708944Help
Entry
708944            CDS       T01028                                 

Gene name
TAAR1
Definition
(RefSeq) trace amine-associated receptor 1
  KO
K05051  trace amine associated receptor
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    708944 (TAAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mcc04030]
    708944 (TAAR1)
G protein-coupled receptors [BR:mcc04030]
 Rhodopsin family
  Biogenic amine
   Trace amine
    708944 (TAAR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 708944
NCBI-ProteinID: NP_001074234
Ensembl: ENSMMUG00000015088
UniProt: Q8HZ64
Position
4
AA seq 338 aa AA seqDB search
MPFCHNIINISCVKNNWSNDVRASLYSLMALIILTTLVGNLIVIVSISHFKQLHTPTNWL
IHSMATVDFLLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISIDR
YYAVCDPLRYKAKINILVVCVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRGG
CSVFFSKISGVLAFMTSFYIPGSIMLCIYYRIYLIAKEQARSINDANQKLQIGLEMKNGI
SQSKERKAVKTLGIVMGVFLICWCPFFVCTVIDPFLHYTIPPTLNDVLIWFGYLNSTFNP
MVYAFFYPWFRKALKMILFGKIFQKDSSRCKLFLESSS
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcccttttgccacaatataattaatatttcctgtgtgaaaaacaactggtcaaatgat
gtccgtgcttccctgtacagtttaatggcgctcataattctgaccacattggtcggcaat
ctgatagttattgtttctatatcacacttcaagcaacttcatactccgacaaattggctc
attcattccatggccactgtggactttcttctggggtgtctggtcatgccttacagcatg
gtgagatctgctgagcactgttggtattttggagaagtcttctgtaaaatccacaccagc
accgacattatgctgagctcagcctccattttccatctgtctttcatctccattgaccgc
tactatgctgtgtgtgacccattgagatataaagccaagatcaatatcttggttgtttgt
gtgatgatcttcattagttggagtgtccctgctgtttttgcatttgggatgatctttctg
gagctaaacttcaaaggcgctgaagagatatattacaaacatgttcactgcagaggaggt
tgctctgtgttctttagcaaaatatctggggtactggcctttatgacttctttttacata
cctggatctattatgttatgtatctattacagaatatatcttatagctaaagagcaggca
agatcaattaatgatgccaatcagaagctccaaattggattggaaatgaaaaatggaatt
tcacaaagcaaagaaaggaaagctgtgaagacattggggattgtgatgggagttttccta
atatgctggtgccctttctttgtctgtacagtcatcgacccttttcttcactacactatt
ccacctactttgaacgatgtattgatttggtttggctacttgaactctacatttaatcca
atggtttatgcatttttctatccctggtttagaaaagcactgaagatgattctgtttggt
aaaattttccaaaaggattcatccaggtgtaaattatttttggaatcgagttcatag

DBGET integrated database retrieval system