KEGG   Macaca mulatta (rhesus monkey): 709022Help
Entry
709022            CDS       T01028                                 

Gene name
FBP1
Definition
(RefSeq) fructose-1,6-bisphosphatase 1
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00010  Glycolysis / Gluconeogenesis
mcc00030  Pentose phosphate pathway
mcc00051  Fructose and mannose metabolism
mcc01100  Metabolic pathways
mcc01200  Carbon metabolism
mcc04152  AMPK signaling pathway
mcc04910  Insulin signaling pathway
Module
mcc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    709022 (FBP1)
   00030 Pentose phosphate pathway
    709022 (FBP1)
   00051 Fructose and mannose metabolism
    709022 (FBP1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    709022 (FBP1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    709022 (FBP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    709022 (FBP1)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     709022 (FBP1)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   709022 (FBP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase Inositol_P
Motif
Other DBs
NCBI-GeneID: 709022
NCBI-ProteinID: NP_001180581
Ensembl: ENSMMUG00000022536
Position
15
AA seq 338 aa AA seqDB search
MADQAPFDTDVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGI
AGSTNVTGDQVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDP
LDGSSNIDCLVSIGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDC
GVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAP
YGARYVGSMVADVHRTLVYGGIFLYPANKKSPSGKLRLLYECNPMAYVMEKAGGMATTGK
EAVLDVVPTDIHQRAPVILGSPDDVLEFLEVSKQHSAQ
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggctgaccaggcgcccttcgacacggacgtcaacaccctgacccgcttcgtcatggag
gagggcaggaaggcccgcggcacgggtgagctgacccagctgctcaactcgctctgcacg
gccgtcaaagccatctcctccgcggtgcgcaaggccggcatcgcgcacctctatggcatt
gctggttctaccaacgtgacgggtgatcaagttaagaagctggacgtcctctccaacgac
ctggttatgaacatgttaaagtcatcctttgccacgtgtgttctcgtgtcagaagaagat
aaacacgccatcatagtggaaccagagaaaaggggtaaatatgtggtctgttttgatccc
cttgatggatcttccaacatcgattgccttgtgtccattggaaccatttttggcatctat
agaaagaaatcaactgatgagccttccgaaaaggacgctctgcagccaggccggaacctg
gtggcggccggctacgcgctgtatggcagtgccaccatgctggtccttgccatggactgc
ggggtcaactgcttcatgctggacccggccatcggggagttcattttggtggacaaagat
gtgaagatcaaaaagaaaggtaaaatctacagccttaacgagggctacgccaaggacttt
gaccctgctgtcactgagtacatccagaggaagaagttccccccagataattcagccccc
tatggagcccggtacgtgggctccatggtggccgatgttcaccgcactctggtctacgga
gggatatttctgtaccctgctaacaagaagagccccagcggaaagctgcgactgctgtac
gaatgcaaccccatggcctacgtcatggagaaggccgggggaatggccaccaccgggaag
gaggccgtgctggacgtcgttcccacagacattcaccagagggcgccggtgatcctgggg
tcccccgacgacgtgctcgagttcttggaggtgtctaagcagcactctgcccagtga

DBGET integrated database retrieval system