KEGG   Macaca mulatta (rhesus monkey): 709062Help
Entry
709062            CDS       T01028                                 

Gene name
G6PC2
Definition
(RefSeq) glucose-6-phosphatase catalytic subunit 2
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00010  Glycolysis / Gluconeogenesis
mcc00052  Galactose metabolism
mcc00500  Starch and sucrose metabolism
mcc01100  Metabolic pathways
mcc04068  FoxO signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04910  Insulin signaling pathway
mcc04920  Adipocytokine signaling pathway
mcc04922  Glucagon signaling pathway
mcc04931  Insulin resistance
mcc04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    709062 (G6PC2)
   00052 Galactose metabolism
    709062 (G6PC2)
   00500 Starch and sucrose metabolism
    709062 (G6PC2)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    709062 (G6PC2)
   04151 PI3K-Akt signaling pathway
    709062 (G6PC2)
   04152 AMPK signaling pathway
    709062 (G6PC2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    709062 (G6PC2)
   04922 Glucagon signaling pathway
    709062 (G6PC2)
   04920 Adipocytokine signaling pathway
    709062 (G6PC2)
  Digestive system
   04973 Carbohydrate digestion and absorption
    709062 (G6PC2)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    709062 (G6PC2)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     709062 (G6PC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAP2
Motif
Other DBs
NCBI-GeneID: 709062
NCBI-ProteinID: XP_014965746
Position
12
AA seq 387 aa AA seqDB search
MAQHATKARYKNGGNQSTSAPSALCLELPLFQDGFPHRNEVLIIQHLQKDYRAYYNFLNF
MSNIGDPQNTFFIYFPLWFQLNQTVGTKMIWVAVIGDWFNLIFKWILFGHRPYWWVQETQ
IYPNHSSPCLEQFPTTCETGPGSPSGHAMGSSCVWYVMVTAALSHTVCGMDKFSITLHRL
TWSFLWSVFWLIQISVCISRVFIATHFPHQVIPGVIGGMLVAEAFEHTPGIQMASLGTYL
KTNLFLFLFALGFYLLLRLLNIDLLWSVPIAKKWCANPDWIHVDTTPFAGLVRNLGVLFG
LGFAVNSEMFLLSCRGGYSYTLSFRLLCALTSLTTLHLYHFLQIPTQEEHLFYVLSFCKS
ASIPLTLVTFIPYYVHMLMKQNGKKIQ
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggctcaacatgccacaaaggcacggtataaaaacggtgggaatcagagcacttcagct
ccaagtgctctatgtttagaattgcctctttttcaagatggatttcctcacaggaatgaa
gtgctcataattcagcatttgcagaaggactaccgagcttactacaattttctaaatttt
atgtccaatattggagacccccagaatacctttttcatttattttccgctttggtttcag
cttaatcagacagttggaaccaagatgatatgggtagcagtcattggggattggttcaat
cttatatttaaatggatattatttggtcatcgaccttactggtgggtccaagaaactcag
atttacccaaatcactcaagtccatgccttgaacagttccctactacatgtgaaacaggt
ccaggaagtccatctggccatgcaatgggttcgtcctgtgtctggtatgtcatggtaacc
gctgccctgagccacactgtctgtgggatggataagttctctatcactctgcacagactg
acctggtcatttctttggagtgttttttggttgattcaaatcagtgtctgcatctccaga
gtattcatagcaacacattttcctcatcaagttattcctggagtaattggtggcatgctg
gtggcagaggcctttgaacacactccaggcatccaaatggctagcctgggcacataccta
aagaccaatctcttcctcttcctgtttgcacttggtttttacctgcttcttagactgctc
aacattgacctactgtggtccgtgcccatagccaaaaagtggtgtgccaaccccgactgg
atccacgttgacaccacgccttttgctggactcgtgagaaacctcggggtcctcttcggc
ttgggctttgcagtcaactcggagatgttcctcctgagctgccgaggtggatatagctac
acactgagcttccggttgctctgtgccttgacctcattgaccacattgcacctctaccat
ttcctccagatcccgactcaggaagagcatttattttatgtgctgtctttttgtaaaagt
gcatccattcccctaactttggttactttcattccctactatgttcatatgttaatgaaa
caaaacggaaagaagattcagtag

DBGET integrated database retrieval system