KEGG   Macaca mulatta (rhesus monkey): 709234Help
Entry
709234            CDS       T01028                                 

Gene name
UGT2B4
Definition
(RefSeq) UDP-glucuronosyltransferase 2B19
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00040  Pentose and glucuronate interconversions
mcc00053  Ascorbate and aldarate metabolism
mcc00140  Steroid hormone biosynthesis
mcc00830  Retinol metabolism
mcc00860  Porphyrin and chlorophyll metabolism
mcc00980  Metabolism of xenobiotics by cytochrome P450
mcc00982  Drug metabolism - cytochrome P450
mcc00983  Drug metabolism - other enzymes
mcc01100  Metabolic pathways
mcc05204  Chemical carcinogenesis
Module
mcc_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    709234 (UGT2B4)
   00053 Ascorbate and aldarate metabolism
    709234 (UGT2B4)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    709234 (UGT2B4)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    709234 (UGT2B4)
   00860 Porphyrin and chlorophyll metabolism
    709234 (UGT2B4)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    709234 (UGT2B4)
   00982 Drug metabolism - cytochrome P450
    709234 (UGT2B4)
   00983 Drug metabolism - other enzymes
    709234 (UGT2B4)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    709234 (UGT2B4)
Enzymes [BR:mcc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     709234 (UGT2B4)
Glycosyltransferases [BR:mcc01003]
 Others
  Hydrophobic molecule
   709234 (UGT2B4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Glyco_trans_4_4 Glyco_trans_4_2
Motif
Other DBs
NCBI-GeneID: 709234
NCBI-ProteinID: XP_001107708
Ensembl: ENSMMUG00000039277
UniProt: F6UEQ4
Position
5
AA seq 528 aa AA seqDB search
MSMKWTSALLLIQLSCYLSSGSCGKVLVWPTEFSHWMNIKTILDELVQRGHEVTVLAYST
SILPDPNNPSPLKFEICPTSLTETEFEDSVTQLVKRWSDIRKDTFWPHFLHVQEMMWTYG
DMIRKFCKDVVSNKKLMKKLQESRFDVVLADAISPCGELLAELLKIPFVYSLRFSPGYAL
EKHGGGFLFPPSYVPVSMSELRDQMTFMERVQNMIYMVYFDFWFQVWDVKNWDQFYSEVL
GRPTTLFEIMAKAEIWLIRNYWDFQFPHPLLPNVEFVGGLHCKPAKPLPKEMEEFVQSSG
DNGVVVFSLGSMVSNMSEERANVIASALAKIPQKVLWRFDGNKPDTLGLNTQLYKWLPQN
DLLGHPKTRAFITHGGANGIYEAIYHGIPMVGVPLFADQPDNIAHMKAKGAAVRLDFDTM
SSTDLLNALKTVINDPLYKENAMKLSSIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAA
HDLTWFQYHSLDVIGFLLACVATVIFIITKCLFCVWKFVRTRKKGKRD
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgaaatggacttcagctcttctgctgatacagctgagctgttacttgagctct
gggagttgtggaaaggtgctggtgtggcccacagaattcagccattggatgaatataaag
acaattctggatgagcttgtccagagaggtcatgaggtgactgtactggcatattcaact
tccattcttcctgatcccaacaacccatctcctcttaaatttgaaatttgtccgacatct
ttaaccgaaactgagtttgaggatagcgtcacgcaactggttaagagatggtcagacatt
cgaaaagacacattttggccacattttttacacgtacaagaaatgatgtggacatatggt
gacatgattagaaagttctgtaaagatgtggtttctaataagaaacttatgaagaaacta
caggagtcaagatttgatgttgttcttgcggatgctatttccccctgtggtgagctactg
gctgagctacttaaaataccctttgtgtacagcctccgcttctctcctggctacgcactt
gaaaagcatggtggagggtttctgttccctccttcctatgtacctgtttctatgtcagaa
ttaagagatcaaatgactttcatggagagagtacaaaatatgatctatatggtttatttt
gacttttggttccaagtatgggatgtaaagaactgggatcagttttacagtgaagttcta
ggaagacccactacattatttgagataatggcaaaagctgaaatatggcttattcgaaac
tactgggattttcaatttcctcatccactcttaccaaatgttgagttcgttggaggactc
cactgcaaacctgccaaacccctacctaaggaaatggaagagttcgtccagagctctgga
gacaatggtgttgtggtgttttctctggggtccatggtcagtaacatgtcagaagaaagg
gccaacgtaattgcatcagcccttgccaagatcccacaaaaggttctgtggagatttgat
gggaataaaccagataccttaggactcaatactcagctgtacaagtggctaccccagaat
gatcttcttggtcatccaaaaaccagagcttttataactcacggtggagccaatggcatc
tacgaggcaatctaccatggaatccctatggtgggcgttccattgtttgccgatcaacct
gataacattgctcacatgaaggccaaaggagcagctgttagactggacttcgacacaatg
tcgagtacagacttactcaatgcactgaagacagtaataaatgatcctttatataaagag
aatgctatgaaattatcaagcattcatcatgatcaaccagtgaagcccctggatcgagca
gtcttctggattgaatttgtcatgcgccataaaggagccaaacaccttcgggttgcagcc
catgacctcacctggttccagtaccactctttggatgtgattgggttcctgctggcctgt
gtggcaactgtgatattcatcatcacaaaatgtctgttttgtgtctggaagtttgttaga
acaagaaagaagggaaaaagagattaa

DBGET integrated database retrieval system