KEGG   Macaca mulatta (rhesus monkey): 709493
Entry
709493            CDS       T01028                                 
Symbol
COL6A2
Name
(RefSeq) collagen alpha-2(VI) chain isoform X2
  KO
K06238  collagen type VI alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04512  ECM-receptor interaction
mcc04974  Protein digestion and absorption
mcc05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    709493 (COL6A2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    709493 (COL6A2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    709493 (COL6A2)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    709493 (COL6A2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    709493 (COL6A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    709493 (COL6A2)
   00536 Glycosaminoglycan binding proteins [BR:mcc00536]
    709493 (COL6A2)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   709493 (COL6A2)
Glycosaminoglycan binding proteins [BR:mcc00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   709493 (COL6A2)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   709493 (COL6A2)
SSDB
Motif
Pfam: VWA Collagen VWA_2 VWA_3 Ins134_P3_kin_N FAM180
Other DBs
NCBI-GeneID: 709493
NCBI-ProteinID: XP_014988164
Ensembl: ENSMMUG00000022317
Position
3:complement(648604..684220)
AA seq 918 aa
MLQGPCSVLLLWGILGATQAQQQEVISPDTTERNNNCPEKTDCPIHVYFVLDTSESVTMQ
SPTDILLFHMKQFVPQFISQLQNEFYLDQVALSWRYGGLHFSDQVEVFSPPGSDRASFIK
SLQGISSFRRGTFTDCALANMTEQIRQHGTKGTVHFAVVITDGHVTGSPCGGIKLQAERA
REEGIRLFAVAPNRNLKEQGLRDIASTPHELYRNDYATMLPDSTEIDQDTINRIIKVMKH
EAYGECYRVSCLEIPGPPGPKGYRGQKGAKGNMGEPGEPGQKGRQGDPGIEGPIGFPGPK
GVPGFKGEKGEFGADGRKGAPGLAGKNGTDGQKGKLGRIGPPGCKGDPGNRGPDGYPGEA
GSPGERGDQGGKGDPGRPGRRGPPGDIGAKGSKGYQGNNGAPGSHGVKGAKGGPGPRGPK
GEPGRRGDPGTKGSPGSDGPKGEKGDPGPEGPRGLAGEVGNKGAKGDRGLPGPRGPQGAL
GEPGNQGSRGDPGDAGPRGDSGQPGPKGDPGRPGFSYPGPRGAPGDKGEPGPRGPEGGRG
DFGLKGEPGRKGEKGEPADPGPPGEPGPRGPRGVPGPEGEPGPPGDPGLTECDVMTYVRE
TCGCCDCEKRCGALDVVFVIDSSESIGYTNFTLEKNFVINVVNRLGAIAKDPKSETGTRV
GVVQYSHEGTFEAIQLDDERIDSLSSFKEAVKNLEWIAGGTWTPSALKFAYDRLIKESRR
QKTRVFAVVITDGRHDPRDDDLNLRALCDRDVTVTAIGIGDMFHEKHESENLYSIACDKP
QQVRNMTLFSDLVAEKFIDDMEDVLCPDPQIVCPDLPCQTDAPWPGGESPVTFLRTEEGP
DATFPRTIPLIQQLLNATELTQDPAAYSQLVAVLVYTAERAKFATGVERQDWMELFIDTF
KLVHRDIVGDPETALALC
NT seq 2757 nt   +upstreamnt  +downstreamnt
atgctccagggcccctgctccgtgctcctgctctggggaatcctgggggccacccaggcc
cagcagcaggaggtcatctcgccagatactacggagagaaacaacaactgcccagagaag
acggactgccccatccatgtgtacttcgtgctggacacctcggagagcgtcaccatgcag
tcccccaccgacatcctgcttttccacatgaagcagttcgtgccgcagttcatcagccag
ctgcagaacgagttctacctggaccaggtggcactgagctggcgctacgggggcctgcac
ttctccgaccaggtggaggtgttcagcccaccgggcagcgaccgggcctccttcatcaag
agcctgcagggcatcagctccttccgccgcggcaccttcactgactgcgcgctggccaac
atgacggagcagatccggcagcacggcaccaagggcaccgtccacttcgccgtggtcatc
accgacggccacgtcaccggcagcccctgcgggggcatcaagctgcaggccgagcgggcc
cgcgaggagggcatccggctcttcgccgtggcccccaaccggaacctgaaggagcagggc
ctgcgggacatcgccagcacgccgcacgagctctaccgcaacgactacgccaccatgctg
cccgactccaccgagatcgaccaggacaccatcaaccgcatcatcaaggtcatgaaacac
gaagcctacggagagtgctacagggtgagctgcctggaaatccctgggccccccggcccc
aagggctaccgtggacagaagggtgccaagggcaacatgggtgagccgggagagcctggc
cagaagggaagacagggagacccaggcatcgaaggccccattggattcccaggacccaag
ggcgttcctggcttcaaaggagagaagggtgaatttggagccgacggtcgcaagggggcc
cctggcctggctggcaagaatgggaccgatggacagaagggcaagctggggcgcatcgga
cctcctggttgcaagggagaccccggaaaccggggccccgatggttacccaggggaagca
gggagtccgggggagcgaggagaccaaggcggcaagggggaccctggccgcccaggacgc
agagggcccccgggagacatcggggcgaagggaagcaaggggtatcaaggcaacaatgga
gccccaggaagtcatggtgtgaagggagccaagggtgggcctgggccccgtggacccaaa
ggcgagccggggcgcaggggagaccccggcaccaagggcagcccaggcagcgacggcccc
aagggggagaagggggaccctggccctgaggggccccgcggcctggctggagaggttggc
aacaaaggagccaagggagaccgaggcttgcctggacccagaggcccccagggggctctt
ggggagcccggaaaccagggatctcggggagaccccggtgatgcaggaccccgtggagac
tcaggacagccaggccccaagggagaccccggcaggcctggattcagctacccaggaccc
cgaggagcacctggagacaaaggcgagcccggcccacgcggccccgagggcggccgaggc
gactttggcttgaaaggagaacctgggaggaaaggagagaaaggagagcctgcggatcct
ggtccccctggtgagccaggccctcgggggccaagaggagtcccaggacccgagggtgag
cctggaccccctggagaccccggcctgacggagtgtgacgtcatgacctacgtgagggag
acctgcgggtgctgcgactgcgagaagcgctgtggcgccctggacgtcgtcttcgtcatc
gacagctccgagagcatcgggtacaccaacttcacgctggagaagaactttgtcatcaac
gtggtcaacaggctgggcgccatcgcgaaggaccccaagtccgagacagggacgcgcgtg
ggcgtggtgcagtacagccacgagggcaccttcgaggccatccagctggacgacgaacgc
atcgactccctgtcgagctttaaggaggccgtcaagaacctcgagtggatcgcgggcggc
acctggacaccctcggccctcaagtttgcctacgaccgtctcatcaaggagagccggcgc
cagaaaacacgcgtgtttgcggtggtcatcacggacgggcgccacgaccctcgggatgat
gacctcaacctgcgggcgctgtgtgaccgcgacgtcacagtgacggccatcggcattggc
gacatgttccacgagaagcacgagagcgagaacctgtactccatagcctgcgacaagcca
cagcaggtgcgcaacatgacgctgttctccgacctggtggctgagaagttcattgacgac
atggaggacgtcctctgcccggaccctcagatcgtgtgcccagaccttccctgccaaaca
gatgcaccgtggcctggcggcgagtccccggtcaccttcctccgcacggaagaggggccg
gacgccaccttccccaggaccatccccctgatccaacagttgctaaacgccacggagctc
acacaggacccggccgcctactcccagctggtggccgtgctggtctacaccgccgagcgg
gccaagttcgccaccggggtagagcggcaggactggatggagctgttcattgacaccttt
aagctggttcacagggacatcgtgggcgaccctgagaccgcgttggccctctgctga

DBGET integrated database retrieval system