KEGG   Macaca mulatta (rhesus monkey): 709574
Entry
709574            CDS       T01028                                 

Gene name
BOLA2B
Definition
(RefSeq) bolA-like protein 2
Organism
mcc  Macaca mulatta (rhesus monkey)
SSDB
Motif
Pfam: BolA
Other DBs
NCBI-GeneID: 709574
NCBI-ProteinID: NP_001181399
Ensembl: ENSMMUG00000007331
Position
20
AA seq 152 aa
MASAKSPDRWKARLLEGGSTALMYALVRAEVSFPAEVAPVRLQGSVAGVGAGVVSPLGCR
PSWTTAMELSAEYLREKLQRDLEAEHVEVEDTTLNRCACSFRVLVVSAKFEGKPLLQRHR
LVNTCLAEELPHIHAFEQKTLTPEQWARERQK
NT seq 459 nt   +upstreamnt  +downstreamnt
atggcaagcgcgaaaagcccggaccgttggaaagcccggctgcttgagggcggaagtact
gcgttgatgtacgccttagtaagggcggaagtgagtttcccagcggaagtggctcctgta
aggctgcaaggcagcgtggccggcgtcggagcaggggttgtgtccccgctgggctgccgt
cccagctggactaccgccatggaactcagcgccgaatacctccgggagaagctgcagcgg
gacctggaggcggagcatgtggaggtggaggacacgaccctcaaccgttgcgcctgtagc
ttccgagtcctggtggtgtcggccaagttcgaggggaaaccgctgcttcagagacacagg
ctggtaaacacgtgcctagcagaagagctcccgcacatccatgcctttgaacagaaaacc
ctgaccccagagcagtgggcacgtgagcgacagaaatga

DBGET integrated database retrieval system