KEGG   Macaca mulatta (rhesus monkey): 709837Help
Entry
709837            CDS       T01028                                 

Gene name
CPT1A
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00071  Fatty acid degradation
mcc01212  Fatty acid metabolism
mcc03320  PPAR signaling pathway
mcc04152  AMPK signaling pathway
mcc04714  Thermogenesis
mcc04920  Adipocytokine signaling pathway
mcc04922  Glucagon signaling pathway
mcc04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    709837 (CPT1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    709837 (CPT1A)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    709837 (CPT1A)
   04920 Adipocytokine signaling pathway
    709837 (CPT1A)
   03320 PPAR signaling pathway
    709837 (CPT1A)
  09159 Environmental adaptation
   04714 Thermogenesis
    709837 (CPT1A)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    709837 (CPT1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mcc03029]
    709837 (CPT1A)
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     709837 (CPT1A)
Mitochondrial biogenesis [BR:mcc03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    709837 (CPT1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 709837
NCBI-ProteinID: XP_014968962
Ensembl: ENSMMUG00000001780
Position
14
AA seq 773 aa AA seqDB search
MAEAHQAVAFQFTVTPDGIDLRLSHEALRQIYLSGLHSWKKKFIRFKNGIITGVYPASPS
SWLIVVVGVMTTMYAKIDPSLGIIAKINRTLETTDCMSSQTKNVVSGMLFGTGLWVALIV
TMRYSLKVLLSYHGWMFTEHGKMSRATKIWMGMVKIFSGRKPMLYSFQTSLPRLPVPAVK
DTVNRYLESVRPLMKEEDFKRMTALAQDFAVSLGPRLQWYLKLKSWWATNYVSDWWEEYI
YLRGRGPLMVNSNYYAMDLLYVLPTHIQAARAGNTVHAILLYRRKLDREEIKPIRLLGST
IPLCSAQWERMFNTSRIPGEETDTIQHMRDSKHIVVYHRGRYFKVWLYHDGRLLKPREME
QQMQRILDNTSEPQPGEARLAALTAGDRVPWARCRQAYFGRGKNKQSLDAVEKAAFFVTL
DETEQGYRTEDPDTSMDSYAKSLLHGQCYDRWFDKSFTFVVFKNGKIGINAEHSWADAPI
MAHLWEYVMSTDSLQLGYAEDGHCKGDTNPNIPYPTRLQWDIPGECQEVIETSLNTANLL
ANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREG
RTETVRSCTAESCDFVQAMVDPAQTVEQRLKLFKVASEKHQHMYRLAMTGSGIDRHLFCL
YVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGY
GVSYILVGENLINFHISSKFSCPETDSHRFGKHLKEAMFDIITLFGLSSNSKK
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagctcaccaagctgtagcctttcagttcacggtcactccggatgggatcgac
ctgcggctgagccatgaagctcttagacaaatctatctctctggacttcattcctggaag
aagaagttcatccgattcaagaatggcatcatcactggcgtgtacccggcgagcccctcc
agttggcttatcgtggtggtgggtgtgatgacaacaatgtatgccaagatcgacccctcg
ttaggaataattgcaaaaatcaatcggaccctggaaacaactgactgcatgtccagccag
acaaagaacgtggtcagcggcatgctgtttggcaccgggctgtgggtggccctcatcgtc
accatgcgctactccctgaaggtgctgctgtcctaccacgggtggatgttcactgagcac
ggcaagatgagtcgcgccaccaagatctggatgggtatggtcaagatcttttcaggccga
aaacccatgttgtacagcttccagacatcgctgcctcgcctgccggtcccggctgtcaaa
gacactgtgaacaggtatctagagtcggtgaggcctcttatgaaggaagaagacttcaaa
cggatgacggcacttgctcaagactttgctgtcagtcttggaccaagactacagtggtat
ttgaagttaaaatcctggtgggctacaaattacgtgagcgactggtgggaggagtacatc
tacctccgaggacgagggccgctcatggtgaacagcaactactatgccatggatctgctg
tatgtccttccaactcacattcaggcagcaagagccggcaacaccgtccacgccatcctg
ctttacaggcgcaaactggaccgggaggaaatcaaaccaattcgtcttttgggatccacg
attccactctgctccgctcagtgggagcgaatgtttaacacttcccggatcccaggagag
gagacagacaccatccagcacatgagagacagcaagcacatcgtcgtgtaccatcgaggg
cgctacttcaaggtctggctctaccacgacgggcggctgctgaagccccgggagatggag
cagcagatgcagaggatcctggacaacacctcggagcctcagcctggggaggccaggctg
gcagccctcaccgcaggagacagagttccctgggccaggtgtcgccaggcctattttgga
cgggggaaaaataaacagtctcttgatgctgtggagaaggcagcgttcttcgtgacgtta
gatgaaactgaacaaggatacagaacggaagacccagatacatcgatggacagctacgcc
aagtctctactacatggccaatgttatgacaggtggtttgacaagtcgttcacgtttgtt
gtcttcaaaaacgggaagataggcatcaacgcggagcactcctgggcagacgcgccgatc
atggcccacctttgggagtacgtcatgtccactgacagcctccagttgggctatgcagag
gatgggcactgcaaaggcgacaccaatccgaacattccgtaccccaccaggctgcagtgg
gacatccccggggaatgtcaagaggttatagagacctccctgaacaccgcaaatcttctg
gcaaacgacgtggatttccattccttcccattcgttgcctttggtaaaggaatcatcaag
aaatgtcgcacgagcccagacgcctttgtgcagctggccctccagctggcgcactacaag
gatatgggcaagttttgcctcacatacgaggcctccatgacccggctcttccgagagggg
agaacggagaccgtgcgctcctgcaccgctgagtcgtgcgacttcgtgcaggccatggtg
gacccggcccagacggtggaacagaggctgaaattgttcaaggtggcgtctgagaagcat
cagcatatgtatcgcctcgccatgaccggctccgggatcgatcgtcacctcttctgcctt
tacgtggtgtctaaatatctcgctgtggagtcccctttccttaaggaagttttatctgag
ccttggagattatcaacaagccagacccctcagcagcaagtggagctgtttgacctggag
aataacccagagtacgtgtccagcggagggggctttggaccggttgctgacgatggctat
ggtgtgtcatacatccttgtgggagagaacctcatcaatttccacatttcttccaagttc
tcttgccctgagacggattctcatcgctttggaaagcacctgaaagaagcaatgtttgac
atcatcactttgtttggtctcagttctaattccaaaaagtaa

DBGET integrated database retrieval system