KEGG   Macaca mulatta (rhesus monkey): 709848
Entry
709848            CDS       T01028                                 

Symbol
LPO
Name
(RefSeq) lactoperoxidase
  KO
K12550  lactoperoxidase [EC:1.11.1.7]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04970  Salivary secretion
mcc05208  Chemical carcinogenesis - reactive oxygen species
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    709848 (LPO)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    709848 (LPO)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.7  peroxidase
     709848 (LPO)
SSDB
Motif
Pfam: An_peroxidase
Other DBs
NCBI-GeneID: 709848
NCBI-ProteinID: XP_028692132
Ensembl: ENSMMUG00000002264
Position
16:complement(38533585..38559437)
AA seq 712 aa
MRILLHLPALLASFILLQAAASATRAQTTRTSAISDAVSQAKVQVNKAFLDSRTRLKTAM
SSETPTSRQLSEYLKHAKGRTRTAIRNGQVWEESLKRLGQKASLTNVTDPSLDLTSLSLE
VGCGAPAPVVRCDPCSPYRTITGDCNNRRKPALGAANRALARWLPAEYEDGLSLPFGWTP
GKTRNGFPLPLAREVSNKIVGYLNEEGVLDQNRSLFFMQWGQIVDHDLDFAPDTELGSSE
YSKAQCDEYCIQGDNCFPIMFPPNDPKARTQGKCMPFFRAGFVCPTPPYKSLAREQINAL
TSFLDASFVYSSEPSLASRLRNLSSPLGLMAVNQEVSDHGLPYLPYDSKKPSPCEFINTT
ARVPCFLAGDSRASEHILLATSHTLFLREHNRLARELKRLNPQWDGEKLYQEARKILGAF
VQIITFRDYLPILLGDHMQKWIPPYQGYNESVDPRISNVFTFAFRFGHLEVPSSVFRLDE
NYQPWGPEPELPLHTLFFNTWRMVKDGGIDPLVRGLLAKKSKLMKQNKMMTGELRNKLFQ
PTHRIHGFDLAAINTQRCRDHGQPGYNSWRAFCDLSQPQTLEELNTVLKNKMLAKKLLGL
YGTPDNIDIWIGAIAEPLVERGRVGPLLACLLGKQFQQIRDGDRFWWENPGVFTKEQKDS
LRKMSFSRLVCDNTRITKVPRDPFRANSYPYDFVDCSAIDKLDLSPWASVKN
NT seq 2139 nt   +upstreamnt  +downstreamnt
atgaggatccttctccatctcccagccctcctggcttctttcatcttgcttcaggctgca
gcatctgccacaagagcacagaccaccagaacctctgccatctccgatgctgtgagtcag
gccaaggtccaagtcaacaaggccttcctggactcccgaaccaggctgaagaccgccatg
agctctgagactcccaccagccgacagctctcagagtacctcaagcatgccaaaggccgg
acgcgtacagccatccgcaacggacaggtgtgggaggagtctttaaagagactggggcag
aaggcgtccttgaccaatgtcacagaccccagcctggacttgacttcgctgtctctggag
gtgggctgtggtgcccctgctcccgtggtgagatgcgacccgtgcagcccttaccgcacc
attaccggagactgcaacaacaggaggaagcctgcgctgggcgccgccaacagggctctg
gcgcgctggctgcccgcggagtacgaggacgggctctccctgcccttcggctggacgccg
gggaagacgcgcaacggcttccctctcccgctggcccgggaggtatctaacaagattgtt
ggctatctgaatgaggagggtgttctggaccaaaacaggtccctgttcttcatgcagtgg
ggtcagattgtagatcacgacctggattttgcccctgacaccgagctggggagtagtgag
tactccaaagcccagtgtgatgagtactgtatccagggagacaactgcttccccatcatg
ttcccacccaatgaccccaaggcgaggactcaagggaaatgcatgcctttcttccgagct
ggatttgtctgccccactccaccctacaagtccctggcccgagagcagatcaatgccctg
acttccttcctggatgccagctttgtgtacagctccgagccaagcctggccagccgcctc
cgcaacctcagcagccccctgggcctcatggctgtcaaccaggaggtctcagaccatggg
ctaccctacctgccctatgacagcaagaagccaagcccctgtgagttcatcaacaccaca
gcccgtgtgccctgcttcctggcaggagattctcgagcttcagagcatattctgctggcc
acgtcccacaccctctttctccgcgagcataaccggctggccagggaactaaagagactc
aaccctcagtgggatggagagaagctctaccaggaagcccggaaaatcctgggagccttc
gtgcagattatcacctttagggactacctacccattttgctaggtgaccacatgcagaag
tggatacccccatatcaaggctacaatgaatctgtggatcccagaatttccaatgtcttc
accttcgccttccgctttggccatttggaggtcccctcttctgtgttccgcctggatgag
aattatcagccatgggggccagaaccagaactccccctccacaccctcttcttcaacact
tggaggatggtcaaagatggtggaattgatcctctggtgcggggcctgctggccaagaaa
tccaagctgatgaaacagaataaaatgatgactggagagctgcgcaacaagcttttccag
ccaactcacaggatccatggctttgacctggctgccatcaacacacagcgttgccgggac
catgggcaacctgggtacaattcctggagagccttctgcgacctctcacagccgcagaca
ctagaggagttgaacacagtgctgaagaacaagatgctggccaagaagttactgggtctc
tacgggacccctgacaacatcgacatctggataggggccattgctgagccgctggtggaa
aggggtcgggtggggcctctcctggcctgcctcttgggcaagcagttccagcagatccgc
gatggagacaggttctggtgggaaaaccctggggtcttcacgaaggagcagaaggactct
ttacggaaaatgtccttctcacgccttgtctgtgacaacacccgcatcaccaaggtccca
cgggacccattccgggccaacagctacccctatgacttcgtggattgctcagccattgac
aagctggacctgtcaccctgggcctcagtgaagaattag

DBGET integrated database retrieval system