KEGG   Macaca mulatta (rhesus monkey): 710001Help
Entry
710001            CDS       T01028                                 

Gene name
ZDHHC2
Definition
(RefSeq) palmitoyltransferase ZDHHC2 isoform X1
  KO
K20028  palmitoyltransferase ZDHHC2/15/20 [EC:2.3.1.225]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    710001 (ZDHHC2)
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     710001 (ZDHHC2)
Membrane trafficking [BR:mcc04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    710001 (ZDHHC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 710001
NCBI-ProteinID: XP_015000295
Ensembl: ENSMMUG00000001872
UniProt: I0FKY1
Position
8
AA seq 367 aa AA seqDB search
MAPSGPGSSARRRCRRVLYWIPVVFITLLLGWSYYAYAIQLCIVSMENTGEQVVCLMAYH
LLFGMFVWSYWKTIFTLPMNPSKEFHLSYAEKELLEREPRGEAHQEVLRRAAKDLPIYTR
TMSGAIRYCDRCQLIKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFLAYSL
LYCLFIAATDLQYFIKFWTNGLPDTQAKFHIMFLFFAAAMFSVSLSSLFGYHCWLVSKNK
STLEAFRSPVFRHGTDKNGFSLGFSKNMRQVFGDEKKYWLLPIFSSLGDGCSFPTCLVNQ
DPEQPSTPAGLSSTAKNSENHQFPAKPLRESQSHLLTDSQSWTESSTNPGKCKAGMSNPA
LTMENET
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggcgccctcgggcccgggcagcagcgccaggcggcggtgccggcgggtgctgtactgg
atcccggtggtgttcatcaccctcctgctcggctggtcctactacgcctacgccatccag
ctgtgcatcgtgtccatggaaaacactggtgaacaagttgtgtgcctgatggcctatcat
ctactttttggaatgtttgtctggtcatactggaaaactatctttacattaccaatgaat
ccttcaaaagaattccatctctcttatgcagagaaagaattgttggagagagagccaaga
ggagaagcccatcaggaagttcttaggcgagcagccaaggatcttcccatctataccagg
accatgtctggagccatccgatactgtgacagatgccaacttataaaaccagatcgctgc
catcactgctccgtctgtgataaatgtattttgaagatggatcatcattgcccatgggtg
aacaattgtgttggattttcaaattataagttctttctccttttcttggcttattctctg
ctctactgcctttttattgcggcaaccgatttacagtattttatcaaattttggacaaat
ggcctacctgatactcaagccaagttccatattatgtttttattctttgctgcagctatg
ttttctgtcagcttgtcttctctgtttggctatcattgttggctagtcagcaaaaataaa
tctacattagaggcattcagaagtccagtatttcgacatggaacagataagaatggattc
agcttgggtttcagtaaaaacatgcgacaagtttttggtgatgagaagaagtactggttg
ctacccattttttcaagtctaggtgatggctgctcctttccaacttgccttgttaaccag
gatcctgaacaaccatctactcctgcagggctgagttccacagctaaaaattccgaaaac
catcagtttcctgcaaagccattgagagagtcccagagccaccttcttactgattctcag
tcttggacggagagcagcacaaacccaggaaaatgcaaagcaggtatgagcaatcctgcg
ttaaccatggagaatgagacttaa

DBGET integrated database retrieval system