KEGG   Macaca mulatta (rhesus monkey): 710046Help
Entry
710046            CDS       T01028                                 

Gene name
HTR4
Definition
(RefSeq) 5-hydroxytryptamine receptor 4 isoform X1
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04024  cAMP signaling pathway
mcc04080  Neuroactive ligand-receptor interaction
mcc04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    710046 (HTR4)
   04024 cAMP signaling pathway
    710046 (HTR4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    710046 (HTR4)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    710046 (HTR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mcc04030]
    710046 (HTR4)
G protein-coupled receptors [BR:mcc04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    710046 (HTR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 710046
NCBI-ProteinID: XP_028705660
Ensembl: ENSMMUG00000016913
Position
6
AA seq 388 aa AA seqDB search
MDKFDANVSSKEGFGSVEKVVLLTFLSVVILMAILGNLLVMVAVCWDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDIWIYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSN
STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRP
QSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYSVPGQVWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD
AVECGGQWESQCHPPATSPLVATQPSDT
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggacaaatttgatgctaatgtgagttccaaggagggtttcgggtcagtggagaaggtc
gtgctgctcacgtttctctcggtggttatcctgatggccatcttggggaacctgctggtg
atggtggctgtgtgctgggacaggcagctcaggaaaataaaaacaaattatttcattgta
tctcttgcttttgcggatctgctggtttcggtgctggtgatgccctttggtgccattgag
ctggttcaagacatctggatttatggggagatgttttgtcttgttcggacatctctggac
gtcctgctcacaacagcatcgatttttcacctgtgctgcatttccctggataggtattac
gccatctgctgccagcctttggtctataggaacaagatgacccctctgcgcattgcatta
atgctgggaggctgctgggtcatccccacgtttatttcttttctccctataatgcaaggc
tggaataacattggcataattgatttgatagaaaagaggaagttcaaccagaactctaac
tctacgtactgtgtcttcatggtcaacaagccctatgccatcacctgctctgtggtggcc
ttctacatcccatttctcctcatggtgctggcctattaccgcatctatgtcacagctaag
gagcatgcccaccagatccagatgttacaacgggcaggagcctcctctgagagcaggcct
cagtcggcagaccagcatagcactcaccgcatgaggacagagaccaaagcagccaagacc
ctgtgcatcatcatgggctgcttctgcctctgctgggcaccattctttgtcaccaatatc
gtggatcctttcatagactacagtgtccctgggcaggtgtggaccgctttcctctggctc
ggctatatcaattccgggttgaacccttttctctatgccttcttgaataagtcttttaga
cgtgccttcctcatcatcctctgctgtgatgatgagcgctaccgaagaccttccattctg
ggccagactgtcccttgttcaaccacaaccattaacggatccacacatgtactaagggat
gcagtggagtgtggtggccaatgggagagtcagtgtcacccgccagcaacttctcctttg
gtggctactcagccgagtgacacttag

DBGET integrated database retrieval system