KEGG   Macaca mulatta (rhesus monkey): 710077Help
Entry
710077            CDS       T01028                                 

Gene name
MAP2K7
Definition
(RefSeq) mitogen-activated protein kinase kinase 7
  KO
K04431  mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04012  ErbB signaling pathway
mcc04141  Protein processing in endoplasmic reticulum
mcc04380  Osteoclast differentiation
mcc04530  Tight junction
mcc04620  Toll-like receptor signaling pathway
mcc04660  T cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04668  TNF signaling pathway
mcc04722  Neurotrophin signaling pathway
mcc04912  GnRH signaling pathway
mcc04926  Relaxin signaling pathway
mcc05164  Influenza A
mcc05167  Kaposi's sarcoma-associated herpesvirus infection
mcc05169  Epstein-Barr virus infection
mcc05418  Fluid shear stress and atherosclerosis
Module
mcc_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    710077 (MAP2K7)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    710077 (MAP2K7)
   04012 ErbB signaling pathway
    710077 (MAP2K7)
   04668 TNF signaling pathway
    710077 (MAP2K7)
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    710077 (MAP2K7)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    710077 (MAP2K7)
   04660 T cell receptor signaling pathway
    710077 (MAP2K7)
   04664 Fc epsilon RI signaling pathway
    710077 (MAP2K7)
  Endocrine system
   04912 GnRH signaling pathway
    710077 (MAP2K7)
   04926 Relaxin signaling pathway
    710077 (MAP2K7)
  Nervous system
   04722 Neurotrophin signaling pathway
    710077 (MAP2K7)
  Development
   04380 Osteoclast differentiation
    710077 (MAP2K7)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    710077 (MAP2K7)
  Infectious diseases
   05164 Influenza A
    710077 (MAP2K7)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    710077 (MAP2K7)
   05169 Epstein-Barr virus infection
    710077 (MAP2K7)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     710077 (MAP2K7)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: STE group
  STE7 family
   710077 (MAP2K7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Seadorna_VP7 APH
Motif
Other DBs
NCBI-GeneID: 710077
NCBI-ProteinID: XP_014978196
Ensembl: ENSMMUG00000023755
UniProt: F7A4L9
Position
19
AA seq 435 aa AA seqDB search
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPIIVITLSPAPAPSQRAALQ
LPLANDGGSRSPSSESSPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTG
YLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRIL
MDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTV
AIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYM
APERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLP
GHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESP
RTSGVLSQPHLPFFR
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcctccctggagcagaagctgtcccgcctggaagcaaagctgaagcaggag
aaccgggaggcccggcggaggatcgacctcaacctggatatcagcccccagcggcccagg
cccattattgtgatcactctaagccctgctcctgccccgtcccaacgagcagccctgcag
ctcccgctggccaacgatgggggcagccgctcgccatcctcggagagctccccgcagcac
cccacgccccccgcccggccccgccacatgctggggctcccgtcaaccctgttcacgcct
cgaagcatggagagcattgagattgaccagaagctgcaggagatcatgaagcagacgggc
tacctgaccatcgggggccagcgctaccaggcagaaatcaatgacctggagaacttgggt
gagatgggcagcggcacctgcggccaggtgtggaagatgcgcttccggaagaccggccac
gtcattgccgttaagcaaatgcggcgctcggggaacaaggaggagaacaagcgtatcctc
atggacctggatgtggtgctcaagagccatgactgcccttacattgtgcagtgctttggg
acgtttatcaccaacacggacgtcttcatcgccatggagctcatgggcacctgtgccgag
aagctcaagaagcggatgcagggccccatccccgagcgcatcctgggcaagatgacagtg
gcgattgtgaaggcgctgtactacctgaaggagaagcacggtgtcatccaccgcgacgtc
aagccctccaacatcctgctggacgagcggggccagatcaagctttgcgacttcggcatc
agcggccgcctggtggactccaaagccaaaacgcggagcgccggctgcgcagcctacatg
gcgcccgagcgcattgaccccccagaccccaccaagccagactatgacatccgggccgat
gtatggagcctgggcatctcgttggtggagctggcaacaggacagtttccctacaagaac
tgcaagacggactttgaggtcctcaccaaagtcctacaggaagagcccccgcttctgccc
ggacacatgggcttctcgggggacttccagtccttcgtcaaagactgccttactaaagat
cacaggaagagaccaaagtataataagctacttgaacacagcttcatcaagcgctacgag
acgctggaggtggacgtggcgtcctggttcaaggatgtcatggcgaagactgagtcaccg
cggactagcggcgtcctgagccagccccacctgcccttcttcaggtag

DBGET integrated database retrieval system