KEGG   Macaca mulatta (rhesus monkey): 710753Help
Entry
710753            CDS       T01028                                 

Gene name
PFN1, profilin-1
Definition
(RefSeq) profilin 1
  KO
K05759  profilin
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04015  Rap1 signaling pathway
mcc04810  Regulation of actin cytoskeleton
mcc05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    710753 (PFN1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    710753 (PFN1)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    710753 (PFN1)
Membrane trafficking [BR:mcc04131]
 Others
  Actin-binding proteins
   Others
    710753 (PFN1)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     710753 (PFN1)
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   710753 (PFN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Profilin
Motif
Other DBs
NCBI-GeneID: 710753
NCBI-ProteinID: XP_014973845
Ensembl: ENSMMUG00000002772
UniProt: F7H2A5
Position
16
AA seq 140 aa AA seqDB search
MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFY
VNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVH
GGLINKKCYEMASHLRRSQY
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg
gccatcgtgggttacaaggactcgccctccgtctgggccgccgtccccgggaaaaccttc
gtcaacatcacgccagctgaggtgggtgtcctggttggcaaagaccggtcaagtttttac
gtcaatgggctgacacttgggggccagaaatgttcggtgatccgggactcactgctgcag
gatggggagtttagcatggatcttcgtaccaagagcaccggtggggcccccaccttcaat
gtcactgtcaccaagactgacaagacgctagtcctgctgatgggcaaagaaggtgtccac
ggtggtttgatcaacaagaaatgttatgaaatggcctcccaccttcggcgctcccagtac
tga

DBGET integrated database retrieval system