KEGG   Macaca mulatta (rhesus monkey): 711440
Entry
711440            CDS       T01028                                 

Definition
(RefSeq) aldo-keto reductase family 1 member C3 homolog
  KO
K00037  3alpha-hydroxysteroid 3-dehydrogenase / chlordecone reductase [EC:1.1.1.50 1.1.1.357 1.1.1.225]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00120  Primary bile acid biosynthesis
mcc00140  Steroid hormone biosynthesis
mcc01100  Metabolic pathways
Module
mcc_M00104  Bile acid biosynthesis, cholesterol => cholate/chenodeoxycholate
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    711440
   00140 Steroid hormone biosynthesis
    711440
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.50  3alpha-hydroxysteroid 3-dehydrogenase (Si-specific)
     711440
    1.1.1.225  chlordecone reductase
     711440
    1.1.1.357  3alpha-hydroxysteroid 3-dehydrogenase
     711440
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 711440
NCBI-ProteinID: XP_001104543
Ensembl: ENSMMUG00000023282
UniProt: A0A1D5QHM1
Position
9
AA seq 323 aa
MDSKHQRVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQ
VGLAIRSKIADGTVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPV
SLKPGEELSPTDENGKLIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNHRQLEMILNKP
GLKYKPVCNQVECHPYFNQSKLLDFCKSKDIVLVAYSALGSQRDKRWVDQNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRENVQVFEFQLTSEDMKAIDGLN
RNLRYFNSDSLASHPNYPYSDEY
NT seq 972 nt   +upstreamnt  +downstreamnt
atggattccaaacaccagcgtgtgaagctaaatgatggccacttcatgcctgtattggga
tttggcacctatgcacctccagaggttcccagaagtaaagctttggaggtcacaaaattg
gcaatagaagctgggttccgccatatagattctgctcatttgtacaataatgaggagcag
gttggactggccatccgaagcaagattgcagatggtactgtgaagagagaagacatattc
tacacttcaaagctttggtccacttttcatcgaccagagttggtccgaccagccttggaa
aactcgctgaaaaaagctcaattggactatgttgacctctatctcattcattctccagtg
tctctaaagccaggtgaggaactttcaccaacagatgaaaatggaaaactaatatttgac
atagtggatctctgtaccacttgggaggccatggagaagtgtaaggatgcaggtttggcc
aagtccatcggggtgtcaaacttcaaccacaggcaactggagatgatcctcaacaagcca
ggactcaagtacaagcccgtctgcaaccaggtagaatgtcatccgtatttcaaccagagt
aaattgctagatttctgcaagtcaaaagatattgttctggttgcctatagtgctctggga
tctcagcgagacaaacgatgggtggaccagaactccccggttctcttggaggacccagtc
ctttgtgccttggcaaaaaagcacaagcgaaccccagccctgattgccctgcgctaccag
ctgcagcgtggggttgtggtcctggccaagagctacaatgagcaacggatcagagagaac
gtgcaggtttttgaattccagttgacttcagaggacatgaaagccatagatggcctaaac
agaaatctccgatattttaacagtgatagtctcgctagccaccctaattatccatattca
gatgaatattaa

DBGET integrated database retrieval system