KEGG   Macaca mulatta (rhesus monkey): 711440Help
Entry
711440            CDS       T01028                                 

Definition
(RefSeq) aldo-keto reductase family 1 member C3 homolog
  KO
K04119  aldo-keto reductase family 1 member C3 [EC:1.1.1.51 1.1.1.188 1.1.1.213 1.1.1.357]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00140  Steroid hormone biosynthesis
mcc00590  Arachidonic acid metabolism
mcc00790  Folate biosynthesis
mcc01100  Metabolic pathways
mcc04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    711440
   00590 Arachidonic acid metabolism
    711440
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    711440
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    711440
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.51  3(or 17)beta-hydroxysteroid dehydrogenase
     711440
    1.1.1.188  prostaglandin-F synthase
     711440
    1.1.1.213  3alpha-hydroxysteroid 3-dehydrogenase (Re-specific)
     711440
    1.1.1.357  3alpha-hydroxysteroid 3-dehydrogenase
     711440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-GeneID: 711440
NCBI-ProteinID: XP_001104543
Ensembl: ENSMMUG00000023282
UniProt: A0A1D5QHM1
Position
9
AA seq 323 aa AA seqDB search
MDSKHQRVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQ
VGLAIRSKIADGTVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPV
SLKPGEELSPTDENGKLIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNHRQLEMILNKP
GLKYKPVCNQVECHPYFNQSKLLDFCKSKDIVLVAYSALGSQRDKRWVDQNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRENVQVFEFQLTSEDMKAIDGLN
RNLRYFNSDSLASHPNYPYSDEY
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggattccaaacaccagcgtgtgaagctaaatgatggccacttcatgcctgtattggga
tttggcacctatgcacctccagaggttcccagaagtaaagctttggaggtcacaaaattg
gcaatagaagctgggttccgccatatagattctgctcatttgtacaataatgaggagcag
gttggactggccatccgaagcaagattgcagatggtactgtgaagagagaagacatattc
tacacttcaaagctttggtccacttttcatcgaccagagttggtccgaccagccttggaa
aactcgctgaaaaaagctcaattggactatgttgacctctatctcattcattctccagtg
tctctaaagccaggtgaggaactttcaccaacagatgaaaatggaaaactaatatttgac
atagtggatctctgtaccacttgggaggccatggagaagtgtaaggatgcaggtttggcc
aagtccatcggggtgtcaaacttcaaccacaggcaactggagatgatcctcaacaagcca
ggactcaagtacaagcccgtctgcaaccaggtagaatgtcatccgtatttcaaccagagt
aaattgctagatttctgcaagtcaaaagatattgttctggttgcctatagtgctctggga
tctcagcgagacaaacgatgggtggaccagaactccccggttctcttggaggacccagtc
ctttgtgccttggcaaaaaagcacaagcgaaccccagccctgattgccctgcgctaccag
ctgcagcgtggggttgtggtcctggccaagagctacaatgagcaacggatcagagagaac
gtgcaggtttttgaattccagttgacttcagaggacatgaaagccatagatggcctaaac
agaaatctccgatattttaacagtgatagtctcgctagccaccctaattatccatattca
gatgaatattaa

DBGET integrated database retrieval system