KEGG   Macaca mulatta (rhesus monkey): 711837
Entry
711837            CDS       T01028                                 

Gene name
CDX1
Definition
(RefSeq) homeobox protein CDX-1
  KO
K09312  homeobox protein CDX1/4
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    711837 (CDX1)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Cad
    711837 (CDX1)
SSDB
Motif
Pfam: Caudal_act Homeodomain Homeobox_KN YdaS_antitoxin CC
Other DBs
NCBI-GeneID: 711837
NCBI-ProteinID: XP_001108012
UniProt: A0A5F8AHN4
Position
6
AA seq 265 aa
MYVGYVLDKDSPLYPGPARPASLGLGPQAYGPPAPPPAPQQYPDFPSYSHLEPAPAPPTA
WGAPFPAPKDDWAAAYGPGPAAPAASPAPLAFGPPPDFSPVPAPPGPGPGLLAQPLVGPG
TPSSPGAQRRTPYEWMRRSVAAGGGSGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYIT
IRRKSELAANLGLTERQVKIWFQNRRAKERKVNKKKQQQQQPPQPPTAHDITATPAGPSL
GGLCPSNTSLLATSSPMPVKEEFLP
NT seq 798 nt   +upstreamnt  +downstreamnt
atgtatgtgggctatgtgctggacaaggattcgcccctgtaccctggccccgccaggccc
gccagcctgggtttgggcccgcaagcctacggccccccggccccgcccccggcaccccag
cagtaccccgacttccccagctactctcacttggagccggcccccgcgcccccgacggcc
tggggggcgcccttccctgcgcccaaagacgactgggccgccgcctacggcccgggcccc
gcggcccctgccgccagcccagctccgctggcattcgggccccctccggactttagcccg
gtgcctgcgccccctgggcccggcccgggcctcctggcgcagcccctcgtgggcccgggc
acaccgtcctcgcccggagcgcagaggcggacgccctacgagtggatgcggcgcagcgtg
gcggccggaggcggcagtggcagcggtaagactcggaccaaggacaagtaccgcgtggtc
tacactgaccaccaacgcctggagctggagaaggagtttcattacagccgttacatcaca
atccggcggaaatcagagctggctgccaatctggggctcactgaaaggcaggtgaagatc
tggttccaaaaccggcgggcaaaggagcgcaaagtgaacaagaagaaacagcagcagcaa
cagcccccacagccaccgacagcccacgacattactgccaccccagccgggccgtccctg
gggggcctgtgccccagcaacactagcctcctggccacctcctccccaatgcctgtcaaa
gaggagtttctgccatag

DBGET integrated database retrieval system