KEGG   Macaca mulatta (rhesus monkey): 712159
Entry
712159            CDS       T01028                                 

Gene name
CALML5
Definition
(RefSeq) calmodulin-like protein 5
  KO
K02183  calmodulin
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04070  Phosphatidylinositol signaling system
mcc04114  Oocyte meiosis
mcc04218  Cellular senescence
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04270  Vascular smooth muscle contraction
mcc04371  Apelin signaling pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04713  Circadian entrainment
mcc04720  Long-term potentiation
mcc04722  Neurotrophin signaling pathway
mcc04728  Dopaminergic synapse
mcc04740  Olfactory transduction
mcc04744  Phototransduction
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04910  Insulin signaling pathway
mcc04912  GnRH signaling pathway
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04921  Oxytocin signaling pathway
mcc04922  Glucagon signaling pathway
mcc04924  Renin secretion
mcc04925  Aldosterone synthesis and secretion
mcc04970  Salivary secretion
mcc04971  Gastric acid secretion
mcc05010  Alzheimer disease
mcc05012  Parkinson disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05031  Amphetamine addiction
mcc05034  Alcoholism
mcc05133  Pertussis
mcc05152  Tuberculosis
mcc05163  Human cytomegalovirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05200  Pathways in cancer
mcc05214  Glioma
mcc05417  Lipid and atherosclerosis
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    712159 (CALML5)
   04015 Rap1 signaling pathway
    712159 (CALML5)
   04371 Apelin signaling pathway
    712159 (CALML5)
   04020 Calcium signaling pathway
    712159 (CALML5)
   04070 Phosphatidylinositol signaling system
    712159 (CALML5)
   04024 cAMP signaling pathway
    712159 (CALML5)
   04022 cGMP-PKG signaling pathway
    712159 (CALML5)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    712159 (CALML5)
   04218 Cellular senescence
    712159 (CALML5)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    712159 (CALML5)
  09152 Endocrine system
   04910 Insulin signaling pathway
    712159 (CALML5)
   04922 Glucagon signaling pathway
    712159 (CALML5)
   04912 GnRH signaling pathway
    712159 (CALML5)
   04915 Estrogen signaling pathway
    712159 (CALML5)
   04921 Oxytocin signaling pathway
    712159 (CALML5)
   04916 Melanogenesis
    712159 (CALML5)
   04924 Renin secretion
    712159 (CALML5)
   04925 Aldosterone synthesis and secretion
    712159 (CALML5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    712159 (CALML5)
   04270 Vascular smooth muscle contraction
    712159 (CALML5)
  09154 Digestive system
   04970 Salivary secretion
    712159 (CALML5)
   04971 Gastric acid secretion
    712159 (CALML5)
  09156 Nervous system
   04728 Dopaminergic synapse
    712159 (CALML5)
   04720 Long-term potentiation
    712159 (CALML5)
   04722 Neurotrophin signaling pathway
    712159 (CALML5)
  09157 Sensory system
   04744 Phototransduction
    712159 (CALML5)
   04740 Olfactory transduction
    712159 (CALML5)
   04750 Inflammatory mediator regulation of TRP channels
    712159 (CALML5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    712159 (CALML5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    712159 (CALML5)
  09162 Cancer: specific types
   05214 Glioma
    712159 (CALML5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    712159 (CALML5)
   05163 Human cytomegalovirus infection
    712159 (CALML5)
   05167 Kaposi sarcoma-associated herpesvirus infection
    712159 (CALML5)
  09171 Infectious disease: bacterial
   05133 Pertussis
    712159 (CALML5)
   05152 Tuberculosis
    712159 (CALML5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    712159 (CALML5)
   05012 Parkinson disease
    712159 (CALML5)
   05022 Pathways of neurodegeneration - multiple diseases
    712159 (CALML5)
  09165 Substance dependence
   05031 Amphetamine addiction
    712159 (CALML5)
   05034 Alcoholism
    712159 (CALML5)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    712159 (CALML5)
   05418 Fluid shear stress and atherosclerosis
    712159 (CALML5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    712159 (CALML5)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    712159 (CALML5)
   03036 Chromosome and associated proteins [BR:mcc03036]
    712159 (CALML5)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    712159 (CALML5)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     712159 (CALML5)
Membrane trafficking [BR:mcc04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    712159 (CALML5)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Centriole replication proteins
     712159 (CALML5)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   712159 (CALML5)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_5 EF-hand_6 EF-hand_9 EF-hand_4 SPARC_Ca_bdg Dockerin_1 TerB EF-hand_11 Phage_TAC_12 Toprim_2 LmeA
Other DBs
NCBI-GeneID: 712159
NCBI-ProteinID: NP_001253591
Ensembl: ENSMMUG00000017446
UniProt: F7HMI0
Position
9
AA seq 146 aa
MAGELTPEQEAEYKSAFSAVDTNGSGTINAQELGAALKAMGKNFSEAELKNLISQFDSDG
DGEISFEEFMAVVKKARAGREDLQVAFRAFDQDGDGHITVDELKQAMAGLGQPLPQEELD
AMIREADVDQDGRVNYEEFARMLTQE
NT seq 441 nt   +upstreamnt  +downstreamnt
atggccggtgagctgactcctgagcaggaggccgagtacaaaagcgccttctccgcggtt
gacacgaatggaagcggcaccatcaatgcccaggagctgggcgcggcgctgaaggccatg
ggcaagaatttctcggaggccgagctaaagaatctcatctcccagtttgatagcgacggc
gacggcgaaatcagcttcgaggagttcatggcggtggtgaagaaggccagggccggccgg
gaggacctgcaggtcgccttccgcgccttcgaccaggacggcgatggccacatcaccgtg
gacgagctcaagcaggccatggcggggctggggcagccgctgccgcaggaggagctggat
gccatgatccgcgaggccgacgtggaccaggacgggcgggtgaactacgaggagttcgcg
aggatgctcacccaggagtga

DBGET integrated database retrieval system