KEGG   Macaca mulatta (rhesus monkey): 712577Help
Entry
712577            CDS       T01028                                 

Gene name
TNFRSF13C
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 13C
  KO
K05151  tumor necrosis factor receptor superfamily member 13C
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04064  NF-kappa B signaling pathway
mcc04672  Intestinal immune network for IgA production
mcc05166  Human T-cell leukemia virus 1 infection
mcc05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    712577 (TNFRSF13C)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    712577 (TNFRSF13C)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    712577 (TNFRSF13C)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    712577 (TNFRSF13C)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    712577 (TNFRSF13C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    712577 (TNFRSF13C)
   04090 CD molecules [BR:mcc04090]
    712577 (TNFRSF13C)
Cytokine receptors [BR:mcc04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   712577 (TNFRSF13C)
CD molecules [BR:mcc04090]
 Proteins
  712577 (TNFRSF13C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BaffR-Tall_bind BatA DUF4079 SKG6 DUF4381 SIT stn_TNFRSF12A Herpes_gE
Motif
Other DBs
NCBI-GeneID: 712577
NCBI-ProteinID: XP_001101623
Position
10
AA seq 184 aa AA seqDB search
MKRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAPASSPAPRTALQPQ
ESVGAGAGEAALSLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGD
KDKDEPLDKVIILSPGISDAAAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAG
PEQQ
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgagggccccggagcctgcggggcagggacgcgccagcccccacgccctgcgtc
ccggccgagtgcttcgacctgctggtccggcactgcgtggcctgcggactcctgcgcacg
ccgcggccgaaaccggccccggccagcagccctgcgcccaggacggcgctgcagccgcaa
gagtcggtgggcgcgggggccggcgaggcggcgctgtccctacccgggctgctcttcggc
gcccccgcgctgctgggcctggcactggtcctggcgctggtcctggtgggcctggtgagc
tggaggcggcgacagcggcggcttcgcggcgcgtcctccgcagaggcccccgacggagac
aaggacaaggacgaacccctggacaaggtcatcattctgtctccgggaatctctgatgcc
gcagctcctgcctggcctcctcctggggaagacccaggaaccaccccacctggccacagt
gtccctgtgccagccacagagctgggctccactgaactggtgaccaccaagacggccggc
cctgagcaacaatag

DBGET integrated database retrieval system