KEGG   Macaca mulatta (rhesus monkey): 713320
Entry
713320            CDS       T01028                                 

Gene name
ASIC1
Definition
(RefSeq) acid-sensing ion channel 1
  KO
K04829  acid-sensing ion channel 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    713320 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mcc04040]
    713320 (ASIC1)
Ion channels [BR:mcc04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   713320 (ASIC1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 713320
NCBI-ProteinID: NP_001247994
Ensembl: ENSMMUG00000006529
UniProt: F7H4L2
Position
11
AA seq 528 aa
MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCFLGSLAVLLCV
CTERVQYYFHYHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNN
RYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCS
AEDFKVVFTRYGKCYTFNSGRDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETS
FEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPWGTCKAVTMDSDLD
FFDSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDQEY
CVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETI
EQKKAYEIAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHKLCRRGKCQKEAKRSSA
DKGVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC
NT seq 1587 nt   +upstreamnt  +downstreamnt
atggaactgaaggccgaggaggaggaggtgggtggcgtccagccggtgagcatccaggcc
ttcgccagcagctccacgctgcacggcctggcccacatcttctcctacgagcggctgtct
ctgaagcgggcattgtgggccctgtgcttcctgggctcgctggctgtgctgctgtgtgtg
tgcacggagcgtgtgcagtactacttccactaccaccatgtcaccaagctcgacgaggtg
gctgcctctcagcttactttccctgctgtcacgctgtgcaacctcaacgagttccgcttt
agccaagtctccaagaatgacctgtatcatgccggcgagcttctggccctgctcaacaac
aggtatgagataccagacacacagatggcagacgaaaagcagctggagatattgcaggac
aaagccaacttccgcagcttcaaacccaaacccttcaacatgcgtgagttctatgaccga
gctgggcacgacattcgagacatgctgctgtcctgccacttccggggagaggtctgtagc
gctgaagacttcaaggtggtcttcacacgctatggaaagtgctacacgttcaactcaggc
cgagatgggcggccgcggctgaagaccatgaagggtgggacaggcaatgggctggaaatc
atgctggacatccagcaggacgagtacctgcctgtgtggggggagactgacgagacgtcc
ttcgaagcaggcatcaaagtacagatccatagtcaggatgaacctcctttcatcgaccag
ctgggctttggcgtggccccaggcttccagacctttgtggcctgccaggagcagcggctc
atctacctgcccccgccctggggcacctgcaaagctgttaccatggactcggatttggat
ttcttcgactcctacagcatcaccgcctgccgcatcgactgtgagacacgctacctggtg
gagaactgcaactgccgcatggtgcacatgccaggggatgccccatactgtactccagag
cagtacaaggagtgtgcagatcctgctctggacttcctggtggagaaggaccaggagtac
tgcgtgtgtgaaatgccttgcaacctgacccgctatggcaaggagctgtccatggtcaag
atccccagcaaagcctcagccaagtacctggccaagaagttcaacaaatctgagcaatac
ataggggagaacatcctggtgctggacattttctttgaagtcctcaactatgagaccatt
gaacagaagaaggcctatgagattgcagggctcctgggtgacatcgggggccagatgggg
ctgttcatcggcgccagcatcctcacagtgctggagctctttgactacgcctacgaggtc
attaagcacaagctgtgccgacgaggaaagtgccagaaggaggccaaaaggagcagtgcg
gacaagggcgtggccctcagcctggacgacgtcaaaagacacaacccgtgcgagagcctc
cggggccaccctgccgggatgacatacgctgccaacatcctacctcaccatccggcccga
ggcacgttcgaggactttacctgctga

DBGET integrated database retrieval system